(data stored in ACNUC1104 zone)

EMBL: CP001966.PE364

CP001966.PE364       Location/Qualifiers
FT   CDS_pept        393832..394281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0376"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: msm:MSMEG_1681
FT                   endoribonuclease L-PSP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77018"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG5"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADG77018.1"
FT                   /translation="MNTPAARPTHRRIRPFNTRDTYPEQNLDNDLCQAVVAGGVVYLRG
FT                   QIGQDLDTRESVGVGDVKVQAHQAMRNISQLLEEAGSSLRDIVKVTVYLTDVRYREVVY
FT                   RVMGEWLAGVYPVSTGLVVDALARPEWLVEIDAVAVLSAPEGVAR"
     atgaacactc ccgccgcgag acccacccat cgtcgtatcc gcccgttcaa tacgagagac        60
     acctatccgg aacagaatct cgacaacgac ctgtgtcagg cggtggtggc cggaggtgtc       120
     gtctaccttc gcggccagat cggtcaagac ttggatacgc gggaatccgt cggagtagga       180
     gacgtgaagg tccaagcgca tcaggcgatg aggaatatct ctcagctgct ggaggaggcg       240
     ggaagctcac tgagagacat cgtgaaggtc accgtctatc tcacggatgt gcgctatcgc       300
     gaggtggtgt accgggtgat gggggaatgg ctcgcgggtg tgtacccggt gtccaccgga       360
     ctggtcgtcg atgcgctcgc ccgccccgag tggctcgtgg agatcgatgc ggtcgcggtg       420
     ctgagcgcgc cagagggtgt ggcccggtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page