(data stored in ACNUC1104 zone)

EMBL: CP001966.PE368

CP001966.PE368       Location/Qualifiers
FT   CDS_pept        396245..397399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0380"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: msm:MSMEG_1679 AmiB; TIGRFAM: amidohydrolase;
FT                   PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77022"
FT                   /db_xref="GOA:D5URG9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG9"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADG77022.1"
FT                   /translation="MTSLDEAIESVVAGVHPNLLDLARDLFDHPEVAWEEVRSARRVAA
FT                   QLSDHGFEVTERYVGVDTAFAATIGTGGLHFALCAEYDALPGLGHACGHNLISAITVGA
FT                   AISLAPLVDDLGLTLTVLGTPAEEGGGGKIELLERGAFAGQHAAAMVHPGPVDVARAKP
FT                   FAVSHSHIDYRGKAAHAAAYPDRGVNAADAFTVAQVAIGLLRQQLPSSVRVHGVVTHAG
FT                   EAPNSIAEHTEGRWYVRAETLAELESIEPRVMRCFEAGAWATGAELTVSPESKPYAEFR
FT                   TDEQLLACCQSRARAIGRRFDDGGDAMMARASTDMGNVSQALPAIHPYIGIDSLPAVNH
FT                   QPEFAAATLSAAAGTAVAQGAVALAGTVVDAATRSSIRRRLESV"
     atgacctcgc tggacgaggc cattgagtcc gtcgtcgccg gagtgcatcc gaacctactc        60
     gacctggcgc gtgatctgtt cgaccacccg gaagtcgcct gggaggaagt gcgttctgcg       120
     cgacgtgttg ccgcacagtt gtcggaccac ggcttcgagg tgaccgagcg ctatgtcggt       180
     gtggataccg ccttcgcggc gacaatcggc accgggggac tgcatttcgc cctctgtgcg       240
     gagtacgacg cactgccggg actcggccat gcctgtgggc acaacctgat ttcagcgatc       300
     acagtcggtg cagcgatttc gctggccccg ctggtggatg atctgggcct gacgctcaca       360
     gtgctgggca cgccggccga agagggcggt ggcggcaaga tcgagttgct cgaaagagga       420
     gcattcgccg gtcagcatgc ggcggccatg gtgcacccag ggccggtcga tgttgcgcgt       480
     gccaagcctt tcgcggtgtc gcacagtcat atcgactacc gaggaaaggc ggcgcacgcc       540
     gccgcatacc cggatcgcgg tgtcaatgcc gctgatgcct tcaccgtggc tcaggttgcg       600
     atcggattgc tccgccaaca actcccgtca tctgtgcggg tgcacggcgt ggtgactcac       660
     gccggcgagg cgccgaactc gatcgctgag cacaccgagg gccgatggta cgttcgcgcc       720
     gagaccctgg cagaactgga atcgatcgag ccgagagtca tgcgctgttt cgaagcaggg       780
     gcatgggcca ccggggccga actcaccgtg tcgccagaat ccaagcccta cgccgaattc       840
     cgaaccgatg agcagttgtt ggcctgttgt cagtctcggg ctcgtgcgat cggccggcga       900
     ttcgacgatg ggggcgacgc gatgatggcg cgcgcttcca ccgacatggg aaacgtctca       960
     caggccttgc cggctataca cccgtacatc gggatcgact cactccccgc ggtcaatcac      1020
     cagcccgagt tcgccgccgc cacgctctct gcggcggccg gtacagcggt cgctcagggt      1080
     gccgtcgcac tcgccgggac agtggtcgac gccgcgaccc ggtcctctat ccggcggcga      1140
     ctggagtccg tttga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page