(data stored in ACNUC1104 zone)

EMBL: CP001966.PE369

CP001966.PE369       Location/Qualifiers
FT   CDS_pept        397470..399572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0381"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD-
FT                   dependent pyridine nucleotide-disulphide oxidoreductase;
FT                   KEGG: rop:ROP_14630 histamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77023"
FT                   /db_xref="GOA:D5URH0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH0"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG77023.1"
FT                   /translation="MRDPRYDILFEPVRIGPVTARNRFFQVPHCNGMGYRDPSGEAAMR
FT                   RVKAEGGWAVVCTEQVEIHPTSDIGPFIELRLWDDHDLPAIARIAEQIHEGGALAGIEL
FT                   AHNGLNSPNLISRETPLAPQHLPVVSWNLDPVQARAMTKADIADMRRWHADSVRRSLQA
FT                   GYDIVYVYAGHAIGGLHHFLSRRYNNRSDEYGGSLENRVRLIREILEDTREIVEGKAAV
FT                   ACRISVDELLGDEGITRAEMEDVFGLIGELPDLWDLVLGSWEDDSVTSRFGPEGEQEPF
FT                   VTGLRDLTSKPVVGVGRFTSPDTMVRHVTSGILDLIGAARPSIADPFMPNKIERGDLDD
FT                   IRECIGCNICVSGDFTMSPIRCTQNPTMGEEFRRGWHPESIAPKRSSSSVLVIGAGPAG
FT                   LEAARALGNRGYPVTVTEASRILGGRVVGESKLPGLSAWIRVIDYRLHQIARLDNVELY
FT                   RESAMNADDVLDVGFDHVVVATGASWRRDGVGRWHTRPIDIEPGVDVLTPDDIIAGARP
FT                   QGHRVVLFDDDHYYLGAVIAELLASEGFVVTLVTPVPQVSQWTTNTMEAHRIRKRIIEA
FT                   GVEVRTDTAVSTVMVDGVVTACRFTGRTGWIDADSVVLVTARLPHDDLYTALHDRASEW
FT                   SDAGVQSVRGVGDAWAPGTIAAAVWSGHRFAEELDAPLGDAPVPFRREVTQLTIEPVFP
FT                   RPASSS"
     atgcgcgacc ctcgttatga catcctgttc gagccggttc ggatcggacc cgtcacggca        60
     cgcaaccgtt tcttccaggt gccgcattgc aatggcatgg gatatcgaga cccgtccggt       120
     gaggcggcga tgcgccgtgt caaagccgag ggcgggtggg ccgtggtgtg caccgaacag       180
     gtcgagatcc atccgacatc cgacatcggg cctttcatcg aactacgcct ctgggacgac       240
     catgacctac cggcgatcgc gcgaatcgcg gagcagatcc acgaaggtgg ggcattggcc       300
     ggaatcgaac tggctcacaa cggtctgaac agcccgaacc tgatcagtcg ggagacgccg       360
     ttggcgccgc agcacctccc ggtggtctcg tggaatctag atcccgtgca ggccagggcg       420
     atgacgaagg ccgatatcgc tgatatgcgc cgttggcacg cggattcggt ccgccgatcg       480
     ctccaggctg gctacgacat cgtctacgtc tacgccgggc acgcgatagg cggcctacac       540
     cactttctgt cacgcagata caacaaccgt tccgatgaat acggcggaag cctggagaac       600
     cgggtccggc tgatccgcga gatactggag gacactcgcg agatcgtcga ggggaaggcc       660
     gctgtggcgt gcaggatctc ggtcgacgag ttgctcggag acgaagggat cacccgcgct       720
     gagatggagg acgtgttcgg tctcatcggc gaactccccg acctgtggga tctggtgctc       780
     ggcagctggg aagatgactc cgtcacctct cgattcggtc cagaggggga gcaggagccg       840
     ttcgttaccg gcctccggga cctcacatcc aaaccagtgg tcggcgtggg gcgattcacc       900
     tcacccgaca cgatggtgcg ccatgtcacc agcggcatcc tcgacctcat cggtgccgcg       960
     cgcccgtcga tcgccgatcc gttcatgccg aacaagatcg agcggggtga cctcgacgac      1020
     atccgcgagt gcatcggctg caacatctgc gtctcgggcg acttcaccat gtcgccgatc      1080
     cgctgcacgc agaaccccac catgggggaa gagttccgtc gcggatggca ccccgagtcc      1140
     atcgctccca agcgatcgtc gtcgtcggtc ctcgtcatcg gcgccggccc cgccggatta      1200
     gaggcggccc gagcactggg aaatcgtggg tacccggtga cggtgacaga ggcgagccgg      1260
     attctcggtg gccgggtggt aggggaatcg aaacttccgg gcttgtcagc gtggatccgc      1320
     gtgatcgact accgcctaca tcagatcgcc cgactcgaca acgtcgagct ctaccgcgag      1380
     tcggcgatga atgccgacga cgtcctggac gtcggattcg atcacgtcgt ggtggcgacc      1440
     ggtgcctcgt ggcggcggga tggggtgggg cgctggcata ctcgaccgat cgatatcgag      1500
     cccggtgtcg acgttctcac tcctgacgac atcatcgcgg gtgcgcgtcc gcagggccac      1560
     cgagtggttc tgttcgacga cgatcactac tacctcggcg ccgtcatcgc cgaactcctg      1620
     gccagtgagg ggttcgtggt gaccttggtg acgccggttc cgcaggtctc gcagtggacg      1680
     acgaacacga tggaagctca tcggatccgc aagcggatca tcgaagcggg agtcgaagtg      1740
     cgcaccgata ctgcggtatc gaccgtcatg gtggacggcg tcgtcacggc gtgcaggttc      1800
     accggtcgta cggggtggat cgatgcggat tccgtggttc tcgtcaccgc tcgccttccg      1860
     cacgacgatc tgtatacggc cctgcatgac cgggcgagcg agtggtcgga tgcgggagtt      1920
     cagagtgtgc gcggtgttgg cgacgcatgg gcgcccggaa cgatcgcggc ggcggtgtgg      1980
     tccgggcacc ggttcgcgga ggagctcgat gcaccgctcg gtgacgctcc ggtgccattc      2040
     cggcgcgagg tcacgcaact cacgatcgaa cccgtcttcc cacggccggc atcttcgtct      2100
     tga                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page