(data stored in ACNUC1104 zone)

EMBL: CP001966.PE370

CP001966.PE370       Location/Qualifiers
FT   CDS_pept        complement(399604..400512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0382"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rha:RHA1_ro01787 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77024"
FT                   /db_xref="GOA:D5URH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG77024.1"
FT                   /translation="MADYTLRQLEYFVAVAEANSITRAAAAVHLSQSAMSTALADLEGA
FT                   LGVQLVVRHHAKGITLTPAGRELVVASRQLLASAADLRSAAQGLGSSLSGTLSVGCFQV
FT                   VAPYVLPTLLSVASQKLPRLELRTTEVDLADLAEGVADGTFELGIGYDLVDDPRLKRWP
FT                   LRTISPHVLVSGSHPLAQNASVHLSELADEPMALLDLPHSRDYFRRIFAAAGVEPNVRY
FT                   RSTTVETCRALVGRGLAYTVLNFQSAVPMALDGHPVASVPIADASPALTMVLLNAVAAK
FT                   PTRRATVVAELCRDLFGSEGA"
     gtggccgact acacgctccg acaactggaa tacttcgtgg ccgtggcgga ggccaacagc        60
     atcacgcgtg cagcggcggc ggtccacctg tcgcaatcgg ccatgtccac tgcgttggct       120
     gatctcgaag gcgcgctcgg ggtacaactg gtggtccggc atcacgccaa gggcatcacc       180
     ctgaccccgg ctggacgcga gttggtggtc gcgagccgcc aattgctggc ctccgcagcc       240
     gatctccgat ccgcagccca aggactcggc agctcgctga gcggcacact ctcggtgggg       300
     tgcttccagg tagtcgcgcc gtatgtgttg ccgacgctgt tgtccgtggc gtcacagaag       360
     cttccgagac tggagctgag aacgaccgag gtcgacctcg cagatctcgc ggagggcgta       420
     gccgacggga cgttcgagct gggaatcggc tacgacctgg tggacgaccc ccgcctcaaa       480
     cgttggccgc ttcgcacgat ctctcctcac gtcctggtat cagggtcaca tccgttggcc       540
     cagaacgcca gcgtgcactt gtcggagctc gcggacgagc ccatggcact gctcgatctg       600
     ccgcacagcc gggactactt ccggcgcatc ttcgctgccg caggggtcga accgaacgtc       660
     cgctatcggt cgacgacggt cgagacctgc cgcgccctcg tagggcgtgg tctggcctac       720
     acggttctga acttccagtc ggcggttccc atggccctcg acggacatcc cgtcgcaagc       780
     gttcccattg cggatgcatc gccagcgctg acgatggtgc tgctcaatgc ggtggcggcg       840
     aaacccaccc gccgagcgac agtcgtagcc gagctctgca gggacctgtt cggcagcgag       900
     ggggcgtag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page