(data stored in ACNUC1104 zone)

EMBL: CP001966.PE371

CP001966.PE371       Location/Qualifiers
FT   CDS_pept        complement(400843..401742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0384"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77025"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG77025.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
     atgtacccgc tcgtgaaaga gctcgccgac gacggtgttc ccgtcacggt gtcgtgccgg        60
     gttttgaagc tctcccgtca gccttactac cgttggctcg ccgccccggt ccccgcgacg       120
     gagctggtcg aggcgtatcg cgcgaacgcc ctgttcgacg ccagcgttga tgatccggag       180
     ttcggtcacc ggttactcgc agacgaggcc cgcgctgccg gtgagcctat ggcggaccgc       240
     actgcgtggc ggatctgccg cgacaaccgg tggtggagcg tcttcggaaa gaaacgctcg       300
     agcaagggcg gcaaacccgg gcccgcggtc cacgacgatc tatgcaccgt caccgacgag       360
     cacggcagga ctcgtcaccg gttcaccgca gatgcaccga atcggttgtg gctcacagat       420
     atcactgaac acagggctcg ggaagggaag ctgtatctgt gtgcgatcaa agatgcctac       480
     tccgggcgga tcgtcggcta ctccgtcgac tcgaggatga aggcccggct cgccgtcaac       540
     gccctcaaca acgctgtcgc gatgcgcggt gatgtcaccg gatgcatagt tcatagtgac       600
     agaggatcgc aattccggag ccgaaaattc cgacgtgcct tggaatatca cggactacgc       660
     ggatcaatgg gccgagtcgc ctcctgcggc gacaatgccg cgatggagtc gttcttcagc       720
     ctgctgcaga acaacgtcct cgaccgccac tgctgggcca cccggcagga actgcggacc       780
     gcgatcatca cctggatcga acggacctac caccgccggc gccgacaacg ccgccttgga       840
     cgattgacac ccatcgcatt cgagtccacc atgaacccgg ccgcgccaca cgcggcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page