(data stored in ACNUC1104 zone)

EMBL: CP001966.PE374

CP001966.PE374       Location/Qualifiers
FT   CDS_pept        405131..405982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_38490 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77028"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77028.1"
FT                   /translation="MDLRIDGRVFLVSGATRGIGAAVVRTLLAEGACVGGYARRVADEV
FT                   DDSRQLIGAAEAADAGQVRAFVDRCAERFGRVDGVVANAGQGLIAGPDAPLDVWHDQFD
FT                   QRITHAKNLIDAALPHMRRTDAPVIVLLNAVSAHHPDPEMAPVSAARAALASYAATLSH
FT                   HLAPDRIRVVSVDLGMIDTDRQRARHTASQSPIEYDEWLVDEAVRRGIPWGRAGTRRRS
FT                   PTSLAREEGGGRQRGVRCGEQDRFGTAADRMSKAASIRSGIGMLRFARSATPVRDPGCS
FT                   ST"
     atggacctcc ggatcgacgg cagggtgttc ctggtctccg gcgctacccg cggcatcggg        60
     gcggcggtgg tgcgaacgct gctcgccgaa ggtgcgtgcg tcggtggcta tgcgcgccgc       120
     gtcgccgacg aggtggacga ttcgcggcag ctgatcgggg cggccgaggc cgccgatgcc       180
     gggcaggtgc gcgccttcgt cgatcgctgc gcggagcggt tcggccgggt cgacggagtg       240
     gtcgcgaacg cgggacaggg actcatcgcc ggtcccgacg ctccgctcga cgtgtggcac       300
     gatcagttcg accagcggat cacgcacgcc aagaacctga tcgatgccgc actgccacac       360
     atgcggcgca cggacgcgcc cgtgatcgtg ctgctcaatg cagtgagtgc acatcaccct       420
     gatccggaga tggcgccggt cagcgcggcc cgcgccgcac tcgcgtcgta tgcggccacg       480
     ctgagtcatc acctcgctcc ggaccggatc cgggtggtgt ccgtcgacct cggaatgatc       540
     gacaccgaca ggcaacgcgc acgccatacc gcttcgcaga gcccgatcga gtacgacgag       600
     tggctcgtgg acgaagccgt gcggcgtgga atcccctggg ggcgtgcggg tacccgacgg       660
     aggtcgccga catccctcgc gcgcgaggaa ggcgggggcc gtcagcgagg cgtgcgctgt       720
     ggcgaacagg acaggttcgg tacggcagcg gacaggatgt cgaaggcggc gtcgatccgg       780
     tcgggaatcg ggatgttgcg gttcgcgaga agcgcgacgc cggttcgcga tcccgggtgc       840
     agtagcacgt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page