(data stored in ACNUC1104 zone)

EMBL: CP001966.PE375

CP001966.PE375       Location/Qualifiers
FT   CDS_pept        complement(405832..407010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0388"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="KEGG: mpo:Mpop_1481 beta-lactamase; PFAM:
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77029"
FT                   /db_xref="GOA:D5URH6"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH6"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ADG77029.1"
FT                   /translation="MRSLIAAVLTAAVMTGCSAQPAEHPNQSPSAAPDQVSTTARSVIT
FT                   ELRRAHAIPGIAVAVVLGARTTVVTDGTLGAEDSRAVGPDTLFEIGSVSKIYTALLGAT
FT                   AEADGRISLQDSPARFLPWLRGTPLAGVTLDQLGTYTAGEFPLQFPPSVTDETSMRDYF
FT                   TTWRPTAPAGTTRRYANPSIGLFGLSAAAAYGMDYPVALRERVLTPLDLRDTYISIPDS
FT                   AADRYAWGRTSDSPRVRLSPRPLDAEAYGVKTTPSDLAAFTAAFMNPTTPPAIRSAMQP
FT                   RYEVSPMRQSLGWEGIASPATRKRVQDANAAGITGASRPVTPTGPEPSCLLNKTGSTKG
FT                   FGTYVLLHPGSRTGVALLANRNIPIPDRIDAAFDILSAAVPNLSCSPQRTPR"
     atgcgctccc tgatcgcggc agtactgacc gccgcggtta tgaccggctg ttctgcacag        60
     ccggcggaac acccgaatca gtcacctagc gcagcccccg atcaggtgag caccaccgcg       120
     cgctctgtga tcacggaact acgtcgggca catgctattc caggcatcgc cgtcgcggtg       180
     gtcctgggtg cgcggaccac cgtcgtcacg gacggcacgc tcggcgcgga ggattcccgt       240
     gccgtcggac cggacaccct gttcgagatc ggctcggtga gcaagatcta caccgcgctg       300
     ttgggtgcta ccgccgaagc cgacgggcgg atatcactgc aggacagccc cgcccggttc       360
     ctaccctggc tgcgcggaac tccgctagcc ggcgtgacac tcgatcagct cggcacgtat       420
     accgcaggcg agttcccact tcagtttcca ccgtcggtga ccgacgagac ttcgatgcgc       480
     gactatttca ctacctggcg cccgaccgca ccggcgggca ccactcgccg gtacgccaat       540
     cccagcatcg ggctgttcgg cctgtccgcc gccgctgcgt acgggatgga ctacccggtt       600
     gcgctgcgag agcgagtact cacaccactg gacctgcgcg acacctacat ctccatcccc       660
     gactcagcgg ccgatcggta cgcatggggc cgcacttccg attcgccgcg ggtccggctc       720
     tccccccgtc cactcgacgc cgaggcctac ggcgtcaaga ccacgccgag cgacctcgcg       780
     gcgttcaccg ccgcgttcat gaatccgacc acacccccgg cgatccggtc ggccatgcaa       840
     ccgcgatacg aggtgtcgcc gatgcgacag tcactcggat gggagggcat cgcgagccct       900
     gcgacccgga aacgagtgca ggacgccaac gccgctggca tcacgggcgc gagtaggccc       960
     gtcaccccga ctggccccga gccctcgtgt ctgctcaaca agacgggttc caccaaggga      1020
     ttcggcacct acgtgctact gcacccggga tcgcgaaccg gcgtcgcgct tctcgcgaac      1080
     cgcaacatcc cgattcccga ccggatcgac gccgccttcg acatcctgtc cgctgccgta      1140
     ccgaacctgt cctgttcgcc acagcgcacg cctcgctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page