(data stored in ACNUC1104 zone)

EMBL: CP001966.PE377

CP001966.PE377       Location/Qualifiers
FT   CDS_pept        complement(407941..409158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0390"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: mjl:Mjls_0290 hypothetical protein; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77031"
FT                   /db_xref="GOA:D5URH8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH8"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADG77031.1"
FT                   /translation="MEEEDIGTASGAGGEVIAGLSALERLRARVVFDQYRLIVELLRAR
FT                   VCERIAAGAAQDRWEAGVASEVALALRVSTNRATAMLSRAKVLARDLPATFARLREGDV
FT                   SPEAVEVIVAGVSHLEPRLKTEADTALCGENFAAGGLGLKRLQDTVKQVAYRLDAQATV
FT                   DRVALAAKDRRVTVRPAPDCMARVSILLPVAQAVGVYAALKTAADAVFGVPGEPRSRGQ
FT                   IMADTAFARITGREAAEGQPVTVNLTVPASVLLGDQPGAAHLSGGGTLPGEIARHLVGR
FT                   AAEQAIAWVKRLYVQPESGAVVGLDSRSRLFPRGLAEVIAARDRYCRTPYCDAPIAHTD
FT                   HIAPHAHGGPTSLANGQGLCAACNYAKEAAGWSSRTVDDETGRHTVETHTPTGHVHRST
FT                   APPQAA"
     atggaagagg aagatatcgg cacggcttcg ggggctggcg gtgaggtgat cgccggactg        60
     tccgcgttgg agcggttacg ggcgcgggtg gtgttcgatc agtaccggct gatcgtcgag       120
     ctgctgcggg cgcgggtgtg tgagcggatc gccgccggtg cggcgcagga tcgctgggag       180
     gccggcgtag cgtcggaggt ggcgctcgcg ttgcgagtct cgaccaaccg ggccacggcg       240
     atgctgtccc gggcgaaagt cttggcgcgg gatctgcccg ccaccttcgc gcggctgcgc       300
     gagggtgatg tgtcaccgga agcggtggag gtgatcgtcg ccggtgtctc ccatctggaa       360
     ccccgcctga agaccgaggc cgataccgca ctgtgcggcg agaacttcgc cgcgggtggc       420
     ctgggcctga agcgcttgca ggacacggtc aagcaggtcg cataccggct ggatgcacaa       480
     gccacggtag accgagtcgc tttggccgcc aaggatcgtc gggtcacggt ccgtccggcg       540
     ccggattgca tggcgcgggt atcgatcctg ctaccggtcg cacaggccgt cggcgtgtac       600
     gccgcactga agacggcggc cgatgccgtg ttcggtgtgc cgggtgagcc gcgcagtcgt       660
     gggcagatca tggctgatac cgcgttcgcg cggatcaccg gccgcgaggc ggcagaaggg       720
     caaccggtga cggtgaacct gaccgtccct gcctctgttc tgctgggcga tcagcctggc       780
     gccgcgcacc tctccggcgg tggaacgctg ccgggggaga tcgcccgcca tctggtgggg       840
     cgggcggccg agcaggcgat cgcgtgggtc aaacgcctct acgtgcagcc ggaatcgggt       900
     gctgtggtcg ggttggattc gcggtcgcgg ttgtttcctc gcgggttggc ggaggtgatc       960
     gcggcgcggg atcggtactg ccgcaccccg tactgcgacg ccccgatcgc acacaccgac      1020
     cacatcgccc cgcacgcgca cggcggcccc accagcctgg cgaacgggca ggggctgtgc      1080
     gcggcgtgca actacgccaa ggaagcagcg gggtggtcca gccgcaccgt cgacgacgag      1140
     accggccggc acaccgtcga aactcatacc ccgacagggc atgtgcaccg ttccactgca      1200
     ccgccccagg cggcgtga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page