(data stored in ACNUC1104 zone)

EMBL: CP001966.PE38

CP001966.PE38        Location/Qualifiers
FT   CDS_pept        complement(40993..41511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0038"
FT                   /product="flavoprotein"
FT                   /note="PFAM: flavoprotein; KEGG: fra:Francci3_1816
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76692"
FT                   /db_xref="GOA:D5UPS4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS4"
FT                   /inference="protein motif:PFAM:PF02441"
FT                   /protein_id="ADG76692.1"
FT                   /translation="MSRPTLYLIGCASPPVLQMHEWVDRAQEAGWAACVILSEAAATWL
FT                   TSDQLRHLEESTGHPVRSGPRSPFEPDPLPPAHAAVGVPVTFATLNKIATGVTDTIPVG
FT                   KVCELAGSGLPVALVPRFHEANMTHPQLPLSMTALSTMGIRVAPTGDADDETFDREFDK
FT                   ALAWLRESL"
     atgagtcgcc ccacgctgta tctgatcggc tgtgcctcac ctccggtact gcagatgcac        60
     gagtgggtcg atcgcgcaca ggaggccggg tgggcggcct gtgtcatcct cagcgaagcg       120
     gcggcgacgt ggctgacctc cgaccaactg cggcatctgg aggagagcac cggacacccg       180
     gtccggtccg gtccacgctc accgttcgag cccgatcccc tgccgcctgc gcacgcggcg       240
     gtcggcgttc cagtgacgtt cgcgacgctg aacaagatcg cgaccggagt caccgacacg       300
     atccccgtcg gcaaggtttg tgaattggcc ggatccggac tccccgtcgc actcgtgccc       360
     cgattccacg aggcgaacat gacacacccc caactaccgc tcagcatgac ggcgctctcc       420
     accatgggga tacgggtagc accgacgggc gacgccgacg atgagacctt cgaccgcgaa       480
     ttcgacaagg cactggcatg gttgcgcgaa tcgctctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page