(data stored in ACNUC1104 zone)

EMBL: CP001966.PE381

CP001966.PE381       Location/Qualifiers
FT   CDS_pept        complement(411614..413290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0394"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: nfa:nfa8260 hypothetical protein; PFAM: AAA
FT                   ATPase central domain protein; Tetratricopeptide TPR_4;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77035"
FT                   /db_xref="GOA:D5URI2"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI2"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG77035.1"
FT                   /translation="MTASASALSAFRAGVAALGIQVGEFEATPRDAALARRAFAAATAA
FT                   DPGMADAWLGRAAAGETTAEVLAALHRTADALGSAARRAGLSPGDLAGTFATGMYVDYP
FT                   LRDAATAHVAYAARLLADGAPDDAERALDAAVSCPIERYQRAVVCATGRRWGEVLTALD
FT                   GLGGWDDEALAAAGHAIAGAAAAQLGRFAEAARHLTAAAAGPVPGAAAAARYCHGLVLR
FT                   EQGDEDGARALLERAAPSYPPAEAALRDPNHRLVLASPDEPVAEDAQAEDSADLLAEAA
FT                   AELDRQVGLREVKEQVARLRTTMQLAQVRADRGLSSGARSLHLAFTGPPGTGKTTVARI
FT                   VARMYRGLGLLQTENVVECSRRDLVGQYLGATAIKTSAVIDSALDGVLFIDEAYTLVQD
FT                   GLSGGDAFGREAVDTLLARMENDRDRLVVIIAGYDGEIDRFLGSNEGLASRFARRIRFP
FT                   GYSPGELAEIGEAMARARDAVLTGEAAAVLEACCAGITDRLDQLGNGRFVRNVIEAAEE
FT                   EREMRLAESGADLAGLDEAQLMRIEGADMARALEALVGVAV"
     atgactgctt ctgcatcagc gctgtcggcg ttccgggcgg gcgtcgccgc tctcggtatc        60
     caggtgggtg agttcgaggc cacaccgcga gatgccgcac tggctcgacg ggccttcgcc       120
     gcggctaccg cggccgatcc gggaatggcc gatgcctggt tgggtcgcgc cgccgcgggc       180
     gagaccaccg ccgaggtgct cgcggcgctg caccgcaccg ccgacgcatt ggggtccgcg       240
     gcgcgccgcg ccgggctctc accgggtgat ctggcgggca ccttcgccac cgggatgtac       300
     gtggactacc cgctccggga cgcggccacc gcgcacgtcg cgtacgccgc ccggctgctc       360
     gccgacggtg cgcccgacga tgccgaacgt gccctcgacg ccgcggtgag ctgccccatc       420
     gagcggtatc agcgcgcggt cgtctgtgcc accggccgcc ggtggggcga ggtcctgacc       480
     gcactggacg gactcggtgg ctgggacgac gaggcgctgg ccgcggccgg ccacgccatc       540
     gccggcgccg cggcggcgca gctcggccgg ttcgccgagg cggcgcggca cctcaccgcg       600
     gcggcggcgg gaccggtgcc gggcgccgcg gcggcggcgc ggtactgcca cgggctggtg       660
     ctccgcgagc agggcgacga ggacggcgcc cgcgcactgc tggaacgagc ggcaccgtcg       720
     taccctccgg ccgaggcggc gctgcgcgac ccgaaccacc gcctggtact cgcttccccc       780
     gacgaacccg tggccgagga cgcgcaggcc gaggactccg cggacctgct cgccgaggcc       840
     gccgccgaac tcgaccggca ggtcgggctg cgcgaggtga aggaacaggt ggcacggctg       900
     cgcaccacca tgcagctggc ccaggtgcgc gccgatcgcg ggctgtccag tggcgcccga       960
     tcgctccacc tggcattcac cgggccaccg ggcacgggca agaccacggt ggcccggatc      1020
     gtggcccgga tgtatcgcgg gctggggctg ctgcagaccg agaacgtggt cgagtgctcc      1080
     cggcgcgatc tggtggggca gtacctgggc gccacggcga tcaagaccag cgcggtgatc      1140
     gactccgcgc tcgacggtgt gctcttcatc gacgaggcgt acaccctggt gcaggacggg      1200
     ctgtcgggcg gtgacgcgtt cggccgggaa gccgtcgaca cgcttctggc ccgcatggag      1260
     aacgaccgcg atcgcctggt ggtgatcatc gccggatacg acggcgagat cgaccggttc      1320
     ctcggatcga acgagggcct ggcgtcgcgg ttcgcgcgac ggatccggtt ccccggctac      1380
     tccccgggcg aactcgcgga gatcggcgag gccatggcca gggcccgcga tgcggtgctc      1440
     acgggcgagg ccgcagccgt tctggaggct tgctgtgcgg gcatcaccga ccggctcgac      1500
     caactgggta acggccgctt cgtgcgcaac gtgatcgagg ccgcggaaga ggagcgcgaa      1560
     atgcggctcg cggagtccgg ggcagatctg gccggcctcg acgaggcgca gctcatgcgg      1620
     atcgagggcg ccgatatggc gagagccctc gaagcgctgg taggtgtggc ggtctag         1677
//

If you have problems or comments...

PBIL Back to PBIL home page