(data stored in ACNUC1104 zone)

EMBL: CP001966.PE384

CP001966.PE384       Location/Qualifiers
FT   CDS_pept        414625..417195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0397"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rop:ROP_61080 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77038"
FT                   /db_xref="GOA:D5URI5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG77038.1"
FT                   /translation="MASPMRKVALRNLMAHKGRLFLTVLSVLLGTSFIAGSMVFTGTLS
FT                   KAFDGISDRIAVGVDARVAPKDAQGQGGFGPQGPGVPLSALDRVRAVPGVRIAQPAVTG
FT                   SIALRDGKGDVVSPTGAPQTGGAYLPPGESFESDGLKITEGRAPSGPNEMVLNDSAADR
FT                   LDLPVGSKTTVVTPRSPGPIEATIVGTYTASVDTGGYIGALFAKDEAQKLFGDGATTPN
FT                   IDVAAAPGTSPEQLRDRLAQALPELDVKTGDEVRTEFTDQVNQGLSFLNYFLVAFGLIG
FT                   LLVGVFIIYNTFSMLVAQRLKELALLRAIGASRPQVRNSVVLEALVVGVLGSAAGLATG
FT                   IGLAWLLQAVVKAAGAGFPDTGIVVAPSVAITVMLVGTVVTVISALIPAVRASKVPPVA
FT                   AMRAQDGGSAASVLVRGAIGAALFLSALALLFVATTESGSGAAIMVGVAGFGLVLAVVI
FT                   GGPALVGPVLGGVGTVLAKPFGPAGRLGRTNVMRNPQRTTATAFALVIGVALVGVIGTL
FT                   GASMQKSIDSQVDTGIRSDLVLQAPQFGMPPAALTAIKDVPGIGTKTTLYAVPTRIDGD
FT                   RQNLLAVDGDVNAVFNLTRVAGTLDLKSGGLLIDEDKARAEGWEVGSKVALGSATGREQ
FT                   AETTVTGIYAKAGGLSGPVVTVGEVNTLYPPAQGATSPIVTPQSVFIGAADGTSVEDLK
FT                   DRLREAVKPLLVVNVDDQQDLKDQAGQAITALMGVLYGLLGLAVIIAILGIINTLALSV
FT                   VERRREIGMLRAIGMIRSQVRKSIYLESMLIALFGAVLGLVLGVLLGTSLVYALRDEGL
FT                   GSVVVPWSTVLVMLVASAFVGVGAAILPAIRASRTPPLAAIAEG"
     atggcctcac ccatgcgcaa ggtggccttg cgcaatctga tggcgcacaa gggccggctg        60
     ttcctgacgg tcctctcggt gctcctcggc acctcgttca tcgccggatc gatggtcttc       120
     accggaacgc tgtcgaaggc tttcgacggg atctcggacc ggatcgcggt gggggtcgac       180
     gcgcgagtcg cgccgaagga tgcgcagggg cagggcggtt tcgggccaca gggacccggt       240
     gtcccgctca gcgcgctcga ccgggtccgc gccgtgccgg gtgtgcggat cgcgcagccc       300
     gccgtcaccg gttccatcgc gctccgcgac ggcaagggcg atgtggtctc gcccaccggc       360
     gcgccgcaga ccggcggtgc ctacctgccg ccgggggaga gcttcgagtc cgatggcctg       420
     aagatcaccg agggccgcgc accgtcgggc ccgaacgaga tggtgctcaa cgactccgcg       480
     gccgaccggc tcgatctacc ggtggggtcc aagaccaccg tggtgacgcc gcggtcgccg       540
     gggccgatcg aggcgaccat cgtcggcacg tacaccgcgt cggtcgacac gggcgggtac       600
     atcggcgccc tgttcgcgaa ggacgaggcg cagaagctgt tcggcgacgg cgcgaccaca       660
     ccgaacatcg acgtggccgc ggcgccggga accagccccg agcaactgcg cgaccgtctc       720
     gcgcaggcgc tacccgaact cgacgtcaag accggtgacg aggtgcgcac cgagttcacc       780
     gaccaggtga accaggggct cagcttcctc aattacttcc tcgtcgcctt cggtctgatc       840
     ggtttgctgg taggcgtttt catcatctac aacacgttct cgatgctcgt cgcacagcgc       900
     ctcaaggagc tcgcgctgct gcgcgcgatc ggcgccagcc gtccacaggt acgcaactcc       960
     gtggtgctcg aggcgctcgt cgtcggcgtg ctcggcagtg ctgccggact cgcgaccggc      1020
     atcggtctgg cctggctgtt gcaggccgtg gtgaaggccg cgggtgcggg cttccccgat      1080
     acgggcatcg tggtcgcgcc ctcggtcgcg atcaccgtga tgctcgtggg caccgtggtc      1140
     acggtgatct ccgcgttgat tcccgcggtc cgggcgtcga aagtcccacc cgtggcagcg      1200
     atgcgagcgc aggacggcgg atccgccgca tcggtcctgg tgcgcggcgc gatcggtgcg      1260
     gcccttttcc tcagtgcgct cgcgctgctg ttcgtggcga ccaccgagtc cggttccggt      1320
     gcagcgatca tggtgggcgt cgccggcttc ggactggtgc tcgccgtggt gatcggcggc      1380
     ccggctctcg tcggccccgt gctcggcggc gtcggcacgg tgctcgccaa acccttcggc      1440
     ccggccggcc gattgggccg taccaacgtg atgcgtaatc ctcagcgcac caccgcgacc      1500
     gcgttcgccc tggtgatcgg cgtggcgctg gtgggtgtga tcggcaccct gggggcgtcc      1560
     atgcagaagt cgatcgactc gcaggtcgac acgggtatca ggtccgatct ggtgctgcag      1620
     gcgccgcagt tcgggatgcc gcccgcggcg ctcaccgcga tcaaggacgt ccccggcatc      1680
     ggcaccaaga caacgctgta cgcggtgccc acgcggatcg acggtgaccg gcagaacctg      1740
     ctcgccgtcg acggcgatgt gaacgcggtg ttcaatctga cccgggtcgc cggcacgctg      1800
     gacctgaaat ccggtggcct cctgatcgac gaggacaagg cgcgggcaga gggctgggag      1860
     gtcggctcga aggtcgccct gggctcggcc accggccggg agcaggccga gacgacggtc      1920
     accgggatct atgccaaagc cggtggcctg tccgggccgg tggtcaccgt cggtgaggtg      1980
     aacacgctgt atccgcccgc gcagggggcg accagcccga tcgtcacgcc gcaatcggtc      2040
     ttcatcggcg ccgccgacgg cacctccgtc gaggacctca aggaccggct gcgcgaggcg      2100
     gtcaaaccgt tgctggtggt caatgtcgac gatcagcaag acctcaagga ccaagcaggc      2160
     caggcgatca ccgccctgat gggcgtgctc tacgggctgc tcggcttggc ggtgatcatc      2220
     gcgatcctgg gcatcatcaa cacactggcg ctgtcggtgg tggagcggcg ccgcgagatc      2280
     ggcatgctcc gcgcgatcgg catgatccgc tcccaggtgc gcaagtcgat ctatctcgaa      2340
     tcgatgctga tcgcgctgtt cggcgccgta ctcggcctgg tgctcggcgt gctactgggc      2400
     acgtcgctgg tgtacgcgct gcgtgatgag gggctcggct ccgtggtcgt cccgtggtcg      2460
     acggtgttgg tgatgctggt cgcctcggcc ttcgtcggcg tgggtgcggc gatccttccg      2520
     gccatccgtg cctcccgcac gccgccactc gccgcgatcg cggagggcta g               2571
//

If you have problems or comments...

PBIL Back to PBIL home page