(data stored in ACNUC1104 zone)

EMBL: CP001966.PE385

CP001966.PE385       Location/Qualifiers
FT   CDS_pept        417264..418307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0398"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmi:MMAR_4486 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77039"
FT                   /db_xref="GOA:D5URI6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG77039.1"
FT                   /translation="MKVVVIGAGYAGTIAANRLMKKAGGADVTVVNPRGEFVERVRLHE
FT                   YIAGSGSATTPLADMLNPAIRLVVGSVETIGDGSVTLADGTVLPFDHLVYAAGGAITAP
FT                   AGTVAVGGFESAGRARTALAALPDGALVTVVGGGLTGIETAAEIAESWPALRVRLLSEG
FT                   EIGASLGVGARRRVHRELERLGVQLRRGRYEEPDGAGLVLWAIATQVSDLAARSGLAVD
FT                   DSGRVLVDEFLRSVSDPRIVAVGDGAAVPDARLSCQTALPQGAHGADNLARIIAGAEPK
FT                   RFSMGYTGQNVSIGRRSAVIQTARRDDTPTRIWFGGRPAAFVKEQVCTMARGAARTANY
FT                   AWLPAPK"
     atgaaggtcg tcgtgatcgg tgccggatat gcggggacga tcgccgcgaa ccggctgatg        60
     aagaaggccg gcggcgcgga cgtcacggtg gtgaacccgc gcggcgagtt cgtcgagcgg       120
     gtgcggctgc acgagtacat cgcaggcagc ggctcggcga ccacgccgct ggccgacatg       180
     ctcaatccgg cgatccggct ggtggtcggc tcggtcgaga ccatcggtga tggttcggtg       240
     accctggccg acggcactgt gctgcccttc gatcacctgg tgtacgcggc gggtggggcg       300
     atcacggcac cggcgggcac cgtggcggtg ggcggattcg aatcggccgg ccgggcgcgc       360
     acggcgctcg ccgcactgcc cgacggtgcc ctggtcaccg tggtcggtgg cggtctcacc       420
     ggtatcgaga ccgccgcgga gatcgcggaa tcgtggcccg cgctgcgggt gcggctgctc       480
     agcgagggcg agatcggcgc ctcgctcggt gtcggtgcgc ggcgtcgggt acaccgggag       540
     ctggagcggc tcggagtgca gttgcggcgc ggccggtacg aggaacccga cggtgccggt       600
     ctggtgctgt gggcgatcgc cacgcaggtc agcgatctgg cggcgcgcag cgggctggcc       660
     gtcgacgact ccggccgggt tctggtggac gaattcttgc gcagcgtcag cgatccgcgg       720
     atcgtggcgg tgggtgacgg tgccgccgtg ccggatgcgc ggctgagttg ccagacggcg       780
     ttgccgcagg gggcgcacgg cgcggacaac ctggcccgga tcatcgccgg cgcggagccg       840
     aagcggttct cgatggggta caccgggcag aacgtctcga tcgggcggcg cagcgcggtg       900
     atccagacag ctcgccgcga tgacaccccg acgcggatct ggttcggtgg ccggcccgct       960
     gcgttcgtca aggagcaggt gtgcaccatg gccaggggcg ccgcccgcac cgcgaactac      1020
     gcctggcttc cggcaccgaa atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page