(data stored in ACNUC1104 zone)

EMBL: CP001966.PE386

CP001966.PE386       Location/Qualifiers
FT   CDS_pept        418304..419179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0399"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mva:Mvan_4806 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma-70 factor;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77040"
FT                   /db_xref="GOA:D5URI7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI7"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ADG77040.1"
FT                   /translation="MTTAAEVFTEYRPLLFSIGYEILGSVADTEDVLQESYLRWSDVDL
FT                   AVVENPRAYLARIVTRQALNALRGAARRREQYVGPWLPEPLETPSGDAPTEHVLTGEAV
FT                   TTAMLLVLESLTPTERAVFVLREVFGFGYPEIAEAVGKSEATVRQTAHRARGHVQARRP
FT                   RTVVDPAVAQGAAERFLTAAATGDVQALMDVLAPDAVYLGDGGGVVSAARRPVHGADKV
FT                   ARMLIGLFRKGAAMGEMGLRFAVYNGMPAMVVSFDGVVDQVTCIEVDGAIVTGVYCVRN
FT                   PAKLRSVSMG"
     atgaccaccg cagcagaagt gttcaccgag tatcgaccgc tgttgttctc gatcggatac        60
     gagatcctgg gcagtgtcgc cgataccgag gatgtgctcc aggagagcta cctgcggtgg       120
     agcgatgtgg atctcgccgt ggtcgagaat ccgcgggcgt acctggcgcg catcgtgacc       180
     cggcaggcgc tgaacgcgct gcgcggtgcg gcgcgccggc gcgagcagta cgtgggaccg       240
     tggctaccgg aaccgctgga gacgccgtcg ggtgatgcgc cgaccgaaca cgtgctcacg       300
     ggtgaggcgg tgacgaccgc gatgctgttg gtgttggaat ccctgacccc taccgaacgc       360
     gcggttttcg tgctccgcga ggtgttcggc ttcggctatc cggaaatcgc cgaagcggtg       420
     gggaagagtg aagcgacggt gcgccagacc gcgcaccgcg cccgcggtca tgtccaggcg       480
     cgacgaccgc gcaccgtcgt cgaccccgcg gtggcgcagg gcgcggcgga gcggttcctg       540
     accgcggcgg ctaccggcga tgttcaggcg ctcatggatg tgctggcgcc cgacgcggtg       600
     tacctggggg acggtggcgg cgtggtctcg gcggcccggc gtccggtaca cggcgcggac       660
     aaggtggcgc gcatgctgat cgggttgttc cgcaagggcg ccgcgatggg cgagatggga       720
     ttgcgtttcg cggtgtacaa cggcatgccg gcgatggtcg tctccttcga cggggtcgtc       780
     gatcaggtca cctgtatcga ggtcgacggt gcgatcgtca caggtgtcta ctgcgtgcgg       840
     aacccggcga agctccggag cgtatcgatg gggtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page