(data stored in ACNUC1104 zone)

EMBL: CP001966.PE389

CP001966.PE389       Location/Qualifiers
FT   CDS_pept        422544..423686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0402"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rop:ROP_52370 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77043"
FT                   /db_xref="GOA:D5URJ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG77043.1"
FT                   /translation="MREVLLLCWRDTRHPQGGGSELYLERVGEELARRGVAVTLRTAMY
FT                   PGAARSETVDGVRVSRGGGRFTVYPLALLAIVAARFGRGPLRGIRPDAVIDTQNGIPFF
FT                   ARLVAGVPVTVLVHHCHREQWPVAGRLVARIGWFIESKLSPWVHRRSQYLTVSLPSAEE
FT                   LGLLGVGPERVAVVRNGIDALEPGVADVRSETPRMVVLSRLVPHKQIEDALFVLARLRH
FT                   RVPDLHLDVIGSGWWDDELYRHALRLGVLDRVTFHGHVTEQRKHRLLSRAWVHVMPSRK
FT                   EGWGITVIEAAQHGVPTVGYVSSKGLTDSVVDGATGLLVRDLAGLTEAVAGVLADPLLR
FT                   AELGEKARQRAGEFSWQATADGVGRVLASSVTGDRVGGLV"
     gtgcgtgaag tccttctgct gtgttggcga gacacccgcc acccgcaggg cggcggtagc        60
     gagctgtacc tggaacgggt cggcgaggaa ctggcccgcc gcggtgtggc ggtgaccctg       120
     cgcaccgcga tgtatcccgg tgccgcgcgc tccgagaccg tcgacggggt gcgggtctcc       180
     cgcggcgggg gccgcttcac ggtgtacccg ctggccctgc tcgcgatcgt cgcggcccgg       240
     ttcggccgcg gcccgctgcg cggcatccgt cccgatgcgg tgatcgacac ccagaacggc       300
     atcccgttct tcgcccggct cgtggcgggc gttcccgtca cggtgctggt gcaccactgc       360
     caccgtgagc agtggcccgt ggcggggcgc ctcgtggcgc ggatcggctg gttcatcgaa       420
     tcgaagctct cgccgtgggt gcaccgccgc tcgcagtacc tcaccgtctc gctgccctcg       480
     gccgaggaac tcggcctcct cggtgtggga ccggagcggg tggccgtggt gcgcaacggc       540
     atcgacgcgc tggagcccgg tgtcgcggat gtgcgatctg agaccccgag gatggtggtg       600
     ctctcgcgcc tcgtgccaca caagcagatc gaggacgccc ttttcgtact cgcgcgactg       660
     cgccaccgcg tgcccgacct gcatctggac gtgatcggca gcggctggtg ggacgacgag       720
     ctgtaccgac atgcgctgcg cctcggcgtg ctcgaccggg tgaccttcca cggccacgtg       780
     accgaacagc gcaaacaccg gctgctctcc cgcgcctggg tgcacgtgat gccgtcccgc       840
     aaggagggct ggggtatcac cgtgatcgag gccgcgcagc acggtgtgcc gacggtcggg       900
     tacgtctcgt ccaagggcct caccgattcc gtggtcgacg gcgcgaccgg tctgttggtg       960
     cgcgatctcg ccgggctcac cgaggccgtg gccggtgtgc tcgccgatcc gctgctgcgt      1020
     gccgagctgg gggagaaggc gcgccagcgt gccggagagt tctcctggca ggccaccgcc      1080
     gacggtgtcg gccgggtgct ggcgtcgtcg gtgacgggtg accgcgtggg cggcctggtc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page