(data stored in ACNUC1104 zone)

EMBL: CP001966.PE392

CP001966.PE392       Location/Qualifiers
FT   CDS_pept        424313..425068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77046"
FT                   /db_xref="GOA:D5URJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77046.1"
FT                   /translation="MSNPHPGAVPAPVSSSRSGYDGSGSGKREREAPTVFALPVWLLRW
FT                   AATIVMAVWILGLVAVGAMGWSVEAPFSTKIARGLLFAIAFLSAMVAGQVFRFTRGARP
FT                   LPSRTDTLMFTVYLAANFCLLAAIWSGLPWDRPREGRALLLVGAVLLAAAGGLWIRERK
FT                   RKKNEPAEIEAPIAHRTVATASGERTIKVGLPMPADDGYWVAWWSVAGLPAGYLVHPAF
FT                   GPDSATALARALSAAETAATSTAGSGAPS"
     atgagtaacc cgcaccccgg ggcggttccc gctcccgttt catcatcccg ctccggttac        60
     gacgggagcg ggagtgggaa acgggagcgc gaagccccga ccgtgttcgc cctccccgtg       120
     tggctgctgc ggtgggcggc gacgatcgtg atggcggtgt ggatcctggg gctggtggcg       180
     gtcggcgcga tgggatggtc ggtcgaagcg ccattctcga cgaagatcgc gaggggtctc       240
     ctctttgcca tcgccttcct ctcagcgatg gtcgccggtc aggtcttccg gttcacgcgg       300
     ggcgctcgcc cgcttccgtc tcgcacggac acgctgatgt tcaccgtgta cctcgccgcg       360
     aacttctgcc tgctcgctgc gatctggtcg ggactgccgt gggatcggcc gcgcgagggc       420
     cgggcgctgc tgctcgtggg cgcagtgctg ctcgccgcgg cgggcgggct gtggatccgg       480
     gagcggaagc ggaagaagaa cgagcccgcc gagatcgagg cgccgatcgc ccaccgcacc       540
     gtcgccaccg cgtcgggaga gcggacgatc aaggtcgggc tgccgatgcc ggcggacgac       600
     ggctactggg tcgcatggtg gtcggtcgcc ggactgcccg cggggtacct cgtgcacccg       660
     gcgttcggcc ccgattcggc gaccgccctc gcacgggcac tgagcgcggc ggagaccgcg       720
     gcgacatcaa cggcggggag cggcgcaccg tcgtaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page