(data stored in ACNUC1104 zone)

EMBL: CP001966.PE396

CP001966.PE396       Location/Qualifiers
FT   CDS_pept        429334..429960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0409"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rer:RER_54690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77050"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADG77050.1"
FT                   /translation="MSLRTERVITSGQFSLDGGTWDVDNNVWLIGDDAEVVVVDAAHSA
FT                   DPIVAAVGGRTVRAIVCTHGHNDHVTVAPQLSERLDAPILLHPGDDVLWDMTHAGIAHE
FT                   DLADDQRIAVAGTDIQVIHAPGHSPGSVCLYLPEADELFSGDTLFAGGPGATGRSYSDF
FT                   SVIIDSIRDRLFALPPQTRVNTGHGDGTTLGTESPHLEEWIRRGH"
     gtgagcctgc ggaccgaaag agtcatcacc agtggacagt tcagcctcga cggcggcacc        60
     tgggatgtag acaacaatgt ctggctgatc ggtgacgacg cggaggtcgt ggtggtcgat       120
     gccgcacatt ccgccgaccc gatcgtggcg gcggtgggtg ggcgtacggt gcgcgcgatc       180
     gtgtgcacgc acggacacaa cgatcacgtg acggtagcgc cgcaactgtc cgagcgcctc       240
     gacgccccga tcctgctgca tcccggagac gatgtcctct gggatatgac gcatgccggc       300
     atagcacatg aagacctcgc agatgatcag cggatcgcgg tggcgggcac tgacatccag       360
     gtgatccacg cacccgggca ttcgcctgga tcggtatgtc tgtacctgcc cgaggcggac       420
     gaactgttca gcggcgacac cctgttcgcg ggcggtccgg gcgccaccgg tcgttcgtac       480
     agcgacttct cggtgatcat cgactcgatc cgggaccggc tgttcgccct tcctccgcag       540
     acccgggtga acaccggaca cggtgacggc accacgctcg gcaccgagtc cccgcacctg       600
     gaggagtgga tccgccgcgg gcactga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page