(data stored in ACNUC1104 zone)

EMBL: CP001966.PE398

CP001966.PE398       Location/Qualifiers
FT   CDS_pept        431633..432331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77052"
FT                   /db_xref="GOA:D5URJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77052.1"
FT                   /translation="MSRPKLGAPFSRWWYAWFAVVAVMMVSSVQDRRWATAVLWLAILA
FT                   AATSEIARSLRQRNLAFGIAGILGVVAALLGYAERDWLAVGLGAMIAVVLVAFLPKIRH
FT                   DVPTCRVRTEELVGRTVADATHLLGFDDRRQPAGLSGPELVPMPPGEQDLGDPELIVTA
FT                   VTVVVDAGTQAQIDAATITFGVADSDDPAIPAAGSATSLALTKSEAQDRLVGIVGGGPA
FT                   DIRPRRFPGS"
     gtgagcaggc cgaagctggg tgcgcccttc agtcgctggt ggtacgcgtg gttcgcggta        60
     gtggccgtga tgatggtgag cagcgtgcag gatcgtcgat gggccacggc cgtgctgtgg       120
     ctcgcgatcc tggcggccgc gacatcggag atcgccagat cgctgcgtca gcggaatctc       180
     gccttcggaa tcgctgggat tctgggcgtt gtggcggccc ttctcgggta cgccgagcgc       240
     gattggctcg cggtcggact gggcgcgatg atcgccgtcg tcctggtcgc cttcctgccg       300
     aagatccgtc acgatgtccc cacatgtcgc gtccgtaccg aagaactggt cgggcggacc       360
     gtcgccgacg ccacccatct gttgggcttc gatgaccggc gccagccggc ggggctgtcc       420
     ggcccggagt tggttccgat gccgccgggc gagcaggacc tgggcgaccc ggagctcatc       480
     gtgactgccg tgacggtcgt ggtcgatgcc gggacgcagg cgcagatcga cgccgcgacc       540
     atcacgttcg gcgtcgccga ttcggacgat cccgccatcc ccgcggcggg gagcgcgacg       600
     agcctcgcgc tcaccaagag cgaggcgcag gatcggctgg tcggcatcgt cggcggcggg       660
     cccgcggaca tcaggccgcg acggttccca ggttcttga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page