(data stored in ACNUC1104 zone)

EMBL: CP001966.PE399

CP001966.PE399       Location/Qualifiers
FT   CDS_pept        432396..433100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77053"
FT                   /db_xref="GOA:D5URK0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77053.1"
FT                   /translation="MGPPPNRWGAVLAIAYGPGSAAVQAYAGNWTLAAFVLAVSAGIAA
FT                   FGAPSRRWETTLTCAMVIGFAAMAASGFSRGQTFSVIIGSVLAVVVSLTCWHRRWKAAD
FT                   CRVRTEELVGLTVTQASGLLGFAAGRQPDGLRDPELVAVPAAELDLSEPSLIVTSVVVD
FT                   PTGPALTFGVADGAGLALGRAARGEYQRELSARVGGFPADIRPLRWPGSTGARSMSTVG
FT                   GVADGSRPELQP"
     atgggaccgc cgccgaatcg gtggggcgcc gtcctcgcga tcgcttacgg cccggggagc        60
     gccgccgtgc aggcctatgc cgggaactgg accctcgccg ctttcgtcct cgccgtgtcg       120
     gcgggtatcg ccgcgttcgg cgcaccgtcg cgccggtggg agaccacgct gacctgcgcg       180
     atggtcatcg gcttcgcagc aatggccgcg agcggcttct cccgcgggca gacattcagc       240
     gtgatcatcg gctccgtgct cgcggtggtc gtatcgctca cctgctggca tcgccgctgg       300
     aaggcggcgg actgccgggt gcgcaccgag gaactcgtcg ggctcacggt gacgcaggcg       360
     agcggtcttc tcggattcgc ggccggacgg cagcccgacg ggcttcgcga tccggagctc       420
     gtcgccgtcc ccgcagccga attggacctc tccgaaccgt ctctgatcgt gacctccgtg       480
     gtggtcgacc cgaccgggcc cgcgctcacc ttcggggtcg ccgacggtgc cggcctcgcg       540
     ctcgggcgcg ccgcgcgcgg cgagtaccag cgcgaactca gcgcgcgagt cggcggcttt       600
     cctgccgata tccgtcccct ccgctggccc ggatcaaccg gcgcacgatc gatgtcgact       660
     gtcggcggtg tggcggacgg ctcccgtccc gagctgcagc cgtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page