(data stored in ACNUC1104 zone)

EMBL: CP001966.PE40

CP001966.PE40        Location/Qualifiers
FT   CDS_pept        complement(42899..43486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0040"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5722
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76694"
FT                   /db_xref="GOA:D5UPS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76694.1"
FT                   /translation="METTTGRPGRPPRLNRDKIVATAIEIVTREGYTKLSMRRLADRLG
FT                   TSPMGIYYYFESKNELLGFIASEHDSVAAYLQGAPSNDPYERTVQTSEAMVRFLCAHAW
FT                   ALSGILDGHIRVEEFMANHLDGLARSIGELGFDEEGTAETVRWIWRIVVGEAMTRSRAA
FT                   PTGGLTDTIESYLAGRLVRVRPRRVGREIGSE"
     atggagacga cgacgggccg accaggccgg ccgcctcggc tgaaccggga caagatcgtc        60
     gcgacggcga tcgagatcgt gacgcgcgag ggatacacca agctctccat gcggcgcctc       120
     gccgaccgac tgggcaccag ccccatgggg atctactact acttcgaatc gaagaacgag       180
     ctgctcggct tcatcgccag cgagcacgac agcgtggcgg cctacctgca gggggcaccg       240
     tcgaacgatc cctacgagcg caccgtgcag acctccgagg cgatggtccg gttcctctgc       300
     gcccacgcct gggcgctgtc gggcatcctc gacggccaca tccgggtcga agagttcatg       360
     gcgaaccacc tggacggtct ggcccgcagt atcggcgagc tcggtttcga cgaggaaggg       420
     acggcggaga ccgtgcgctg gatctggcgg atcgtcgtcg gcgaggccat gacccggtct       480
     cgggctgccc cgaccggcgg gctcacggac acgatcgaga gctatctcgc cggcaggctc       540
     gtccgtgtgc ggccgcggcg cgtgggtcgg gagatcgggt cggagtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page