(data stored in ACNUC1104 zone)

EMBL: CP001966.PE403

CP001966.PE403       Location/Qualifiers
FT   CDS_pept        complement(436754..438085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77057"
FT                   /db_xref="GOA:D5URK4"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK4"
FT                   /inference="similar to AA sequence:KEGG:RER_11110"
FT                   /protein_id="ADG77057.1"
FT                   /translation="MAEGRSRLARVIGPILIFLGVLLITSAIAGPAYVAGKLKTIPLDL
FT                   DVTTVAQSVKPADSQADAEFPAKSLDLCSIGKQRAVVNEVSVKTQTRTLVQSPSDKSTM
FT                   TVQSGSSMVIPSIKTKGEPRHPELTNANKGERPCDDGLVQAWVDRVSLDRETGAPTGKT
FT                   SETVYSPGESAPAVKVADRKGLQYRFPADTSKENGKYSFYDLITRKNVALDFVEEKEVS
FT                   GTNTLRLRGSQDWVDMSTVRDGNDPTLGTVLTMPAGWWGIGGVDPKDDITLNRWAKTDV
FT                   ELWVDPKTGIIVDQSLHYTQQFRLPAQVVPNTPKPVRDFKMDVFDAQQRWVDDTVRSQA
FT                   EAAKSEQNKLAVAKTVVPIAGGVLGLIALGLGGFALFQGRTAPGGNGGGRRSDDGAAPT
FT                   LPLDDDATAAAPTDDEPVTEAFNAQPKPDESQTEAIDLRNRDQH"
     atggcggaag gccgcagccg gctcgcacgc gttatcggtc cgatcctgat cttcctgggc        60
     gtgctgctga tcacctccgc gatcgcggga ccggcgtacg tggccggcaa gctgaagacg       120
     atcccgctcg atctggacgt caccaccgtt gcccagtcgg tcaagcccgc tgattcgcag       180
     gccgacgccg agttcccggc gaagtcgctg gacctgtgct cgatcggcaa gcagcgcgcc       240
     gtggtcaacg aggtctcggt gaagacgcag actcgcaccc tggtgcagtc cccgtcggac       300
     aagtcgacga tgaccgtgca gtcgggcagc tcgatggtga ttccgtcgat caagaccaag       360
     ggcgagccgc gtcatccgga gctgacgaac gcgaacaagg gcgagcgccc gtgcgacgac       420
     ggcctggtgc aggcgtgggt cgaccgcgtc tcgctggacc gcgagaccgg cgcccccacc       480
     gggaagacct cggagaccgt gtacagcccg ggtgagagcg ccccggccgt caaggtggcc       540
     gaccgcaagg gcctgcagta ccgcttcccg gcggacacct cgaaggagaa cggcaagtac       600
     tccttctacg acctgatcac ccgcaagaac gtcgcgctcg acttcgtcga ggagaaggag       660
     gtcagcggga ccaacacgct gcgcctacgc ggctcgcagg actgggtgga catgtcgacc       720
     gtccgggacg gcaacgatcc gacactcggc accgtgctca ccatgcccgc cggttggtgg       780
     ggtatcggcg gcgtcgatcc caaggacgac atcaccctca atcgctgggc gaagaccgac       840
     gtcgagctgt gggtggaccc gaagaccggc atcatcgtcg atcagtcgct gcactacacg       900
     cagcagttcc ggctcccggc acaggtggtc ccgaacaccc cgaagccggt ccgcgacttc       960
     aagatggacg tcttcgatgc gcagcagcgc tgggtcgacg acaccgtgcg gtcgcaggcc      1020
     gaggccgcga agtcggagca gaataagctc gccgtcgcga agaccgtggt gccgatcgcc      1080
     ggtggcgtac tgggcctgat cgccctgggc ctgggcggct tcgcgctgtt ccagggccgt      1140
     accgcaccgg gtggcaacgg cggcggtcgc cggtccgacg acggcgcagc ccccacgctg      1200
     ccgctggacg acgatgcgac ggccgcggcg ccgaccgacg acgagccggt gacggaggcg      1260
     ttcaacgccc agccgaagcc ggacgagtcg cagaccgagg cgatcgatct gaggaatcgc      1320
     gaccagcact ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page