(data stored in ACNUC1104 zone)

EMBL: CP001966.PE407

CP001966.PE407       Location/Qualifiers
FT   CDS_pept        complement(443916..444410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0420"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rop:ROP_52450
FT                   putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77061"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK8"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADG77061.1"
FT                   /translation="MTAPVKVLIAYDGTESAQRAVKYASKVLAQGRETEAVVVTAWEST
FT                   IHQAARLSAMSGVAGAGAAETALTRETDVVHTEAKQTNAEGVELARAAGFTARGELVEV
FT                   ATTVWTAIIGASDAENVDVIVTGSRGTTGLKALWHSSVSEHVLRGCKRPVMIVPSGVPE
FT                   L"
     atgactgccc ccgtgaaggt tctgatcgcg tacgacggca ccgagtccgc gcagcgcgct        60
     gtgaagtacg ccagcaaggt cctcgcgcag ggccgcgaga cagaggccgt cgtggtcacc       120
     gcgtgggaat ccaccatcca tcaggcggcc cgcttgtccg ccatgtcggg cgtcgccggg       180
     gccggcgcgg cggagaccgc gctcacccgc gagaccgatg tggtgcacac cgaggccaag       240
     cagaccaacg cggagggtgt cgaactggcc cgcgccgcgg gattcaccgc gcgcggcgaa       300
     ctcgtcgaag tggcgaccac ggtctggacc gcgatcatcg gcgcctcgga cgccgagaac       360
     gtcgatgtga tcgtgaccgg cagccggggc accaccggtc tcaaggcgct gtggcattca       420
     tcggtgtccg agcacgtact ccgcggctgc aagcggccgg tgatgatcgt gccctcgggc       480
     gtcccggagc tgtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page