(data stored in ACNUC1104 zone)

EMBL: CP001966.PE408

CP001966.PE408       Location/Qualifiers
FT   CDS_pept        444568..445296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3767c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77062"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK9"
FT                   /inference="similar to AA sequence:KEGG:MAB_3767c"
FT                   /protein_id="ADG77062.1"
FT                   /translation="MRQRRFGAAVGLVTVGVFVAACNGSSGGGASPSSASPSTPAAAPI
FT                   TTPVKELVLTASELPPGITAVPVTDDQIRASIDQMSGVASTSTITPAECGSATALVDAT
FT                   KKLDVTQLGMVAGSTDTGAATETVVTEKPDLAKFRANFSGKCNAMSARMQVQGQQVTTE
FT                   TRTTVQDAPTSEASDAVVLRQDTDATMSGGERSTQKTLMGIAVVRGYAVSVTVMGMTGE
FT                   PDQALFDKLFTASVAKVAKG"
     atgcggcagc gacggttcgg ggcggcggta ggactggtca cggtgggggt gttcgtggcc        60
     gcgtgcaacg gttcgtcggg cgggggtgca tcgccgtcga gtgcgtcgcc gtcgactccg       120
     gcggccgcgc cgatcaccac gccggtcaag gagctggtgc tcaccgcatc cgagctgccc       180
     ccgggtatca cggcggtccc ggtcaccgat gatcagatca gggcgagcat cgatcagatg       240
     tccggcgtcg cgtccacgtc gaccatcacg ccggccgaat gcggttccgc caccgcgctt       300
     gtggatgcca cgaagaagct cgacgtcacg caactgggga tggtggccgg cagcaccgat       360
     accggtgccg ccacggagac ggtcgtcacc gagaagcccg atctcgccaa gttccgcgcc       420
     aacttctcgg ggaagtgcaa tgcgatgtcg gcccggatgc aggtgcaggg gcaacaggtc       480
     acgaccgaga cccgcacgac cgtgcaggac gcgcccacca gcgaggcttc ggacgccgtc       540
     gtcctgcggc aggacaccga tgccaccatg tccggaggtg agcggtcgac gcagaagacg       600
     ctcatgggca tcgcggtggt gcggggatac gcggtctcgg tcacggtcat gggtatgacg       660
     ggtgagccgg atcaggccct gttcgacaag ctgttcaccg catccgtcgc caaggtcgcc       720
     aagggttga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page