(data stored in ACNUC1104 zone)

EMBL: CP001966.PE410

CP001966.PE410       Location/Qualifiers
FT   CDS_pept        446268..447431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0423"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rop:ROP_52460 putative glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77064"
FT                   /db_xref="GOA:D5URL1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL1"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADG77064.1"
FT                   /translation="MMRLFRNLTVMVIAAAGVAACGTSSGPDAPTSVTSAVPAPNSSTA
FT                   SSSAAARPVSCEIDYLSKLSVREKVAQLLMVGVKDAADARRAVQQYGVGGIFVGSWTDK
FT                   SIFAGGALKQVSAAGKVPLMVSVDEEGGRVSRVPGANLVSARQLAKTKTVEQARAEGKR
FT                   VGALMASMGITVDFAPDADVSAQLADSVIGDRSYSDDPAVVTKYAKAFAAGLRDGGVYP
FT                   VYKHFPGHGHSSGDSHQGGVSVPPLAELKKKDLVPFRAAATDDAGIMVGHLTVPGLTEK
FT                   GTPTSLSPNTMRLLRDGAGYGAAPFAGPIFTDDLSGMKAVTDTFTVPQAVTKALVAGAD
FT                   VALWISTDQLGAAVAQVEAAVRAGTLPMQRLDASVLRVARAKHAVRC"
     atgatgcgat tgtttcgaaa cctcacggtc atggtgatcg ccgcggcggg tgtcgccgcg        60
     tgcggcacat cctccggacc ggacgccccc acgtcggtaa cgtccgcggt acccgcaccg       120
     aacagctcca cggcatcgtc ctcggccgca gctcgcccag tgagctgcga gatcgactac       180
     ctgagcaagc tcagcgtgcg ggagaaggtg gcccagctgc tcatggtggg ggtcaaggat       240
     gccgccgacg ctcgccgtgc ggtacagcag tacggcgtcg gcggcatttt cgtgggcagc       300
     tggacggaca agtcgatctt cgccggtggt gcgctcaaac aagtctcggc cgcgggcaag       360
     gtgccgctca tggtgtcggt cgacgaggag ggcggccgag tatcccgggt gcccggcgcg       420
     aacctggtct ccgcacgcca actcgcgaag accaagacgg tcgagcaggc gcgggccgaa       480
     ggcaagcgag tgggcgccct gatggcgtcg atggggatca ccgtcgactt cgcgcccgat       540
     gcggatgtct ctgcgcagct agctgattcg gtgatcggcg accgctccta ctccgacgac       600
     cccgccgtgg tgaccaaata cgccaaggcc ttcgcggccg ggctgcgtga tggcggcgtc       660
     tacccggtgt acaagcactt cccgggccac ggacactcct ccggggattc gcatcagggc       720
     ggggtgagtg tgccgccgct ggcggagctg aagaagaagg acctggtgcc cttccgcgcc       780
     gccgcgaccg acgacgccgg aatcatggtg gggcacctca cggtgcccgg tctcaccgag       840
     aagggcacac ccaccagcct cagcccgaac acgatgcggt tgctgcgcga cggtgccgga       900
     tacggtgccg ccccgttcgc cggcccgatc ttcaccgacg atctgtccgg gatgaaggcc       960
     gtcaccgaca ccttcacggt gccgcaggcc gtgacgaagg ccctggtggc aggtgctgac      1020
     gtggccctct ggatctccac cgaccaactc ggtgcggccg tcgcgcaggt cgaggcggcg      1080
     gtgcgggcgg gcacgctgcc gatgcagcgg ctcgacgcct cagtgctgcg ggtggcgcgc      1140
     gcgaagcatg cggtgcgctg ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page