(data stored in ACNUC1104 zone)

EMBL: CP001966.PE411

CP001966.PE411       Location/Qualifiers
FT   CDS_pept        447510..448115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0424"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa54640
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77065"
FT                   /db_xref="GOA:D5URL2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77065.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAIKVFSRNGFYETSMDAVAREAEIS
FT                   KPMLYLYYGSKDELFAACVTREVGHFMRSIEFDATPALPPSQRLRSVIEGFLKYVDQNR
FT                   DAWRVMYREASGQASFATLVEANRERVVEMTAVLLREAAKYAPEDTDFELYAVALVGSG
FT                   EAIADRLATGKVELDRAVEIMTSFLWGGIRGERPEDGK"
     gtggctggtg gaacgaagcg tttgccgcgc gcggtgcgcg agcagcagat gctcgacgcc        60
     gctatcaagg tgttctcccg caacgggttc tacgagacgt cgatggacgc cgtggcccgc       120
     gaggcggaga tcagcaagcc gatgctgtac ctgtactacg ggtccaagga tgagctgttc       180
     gccgcgtgtg tcacccgtga ggtgggccat ttcatgcgga gcatcgagtt cgatgccacc       240
     cccgcccttc cgccttcgca gcgcttacgg tcggtgatcg aaggcttcct caagtacgtg       300
     gaccagaacc gcgacgcctg gcgtgtgatg taccgcgagg cgagcggcca ggcgtccttc       360
     gccacgctcg tcgaagccaa tcgcgagcgg gtggtcgaga tgaccgcggt tctcctgcgg       420
     gaggccgcga agtacgcgcc cgaggacacc gatttcgagc tctacgccgt cgccctggtc       480
     ggctccggcg aggccatcgc cgatcgtctc gctaccggga aggtcgaact cgaccgcgcc       540
     gtggagatca tgacctcctt cctgtggggc ggcatccgcg gcgagcgccc ggaagacggc       600
     aagtag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page