(data stored in ACNUC1104 zone)

EMBL: CP001966.PE412

CP001966.PE412       Location/Qualifiers
FT   CDS_pept        complement(448126..448233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77066"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77066.1"
FT                   /translation="MRGTFMFIVKLFGHYLHTSSLSDSLAKESGHVARA"
     atgcggggca cattcatgtt catcgtgaaa ctgttcggcc actatctcca cacgtcctcg        60
     ctgagcgaca gtctcgcgaa ggagtcgggc cacgtggcac gagcgtga                    108
//

If you have problems or comments...

PBIL Back to PBIL home page