(data stored in ACNUC1104 zone)

EMBL: CP001966.PE414

CP001966.PE414       Location/Qualifiers
FT   CDS_pept        complement(449152..450510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rop:ROP_52490 putative
FT                   3-oxoacyl-[acyl- carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77068"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77068.1"
FT                   /translation="MPDAPSTDFYAAFVKSGPGSFLASRLGLPQPPSLRRYQPGKPALA
FT                   GPVLLGGSGRLVEPVRELLADYDLVVNNGGARGAEKLGGAVFDATGITSIDDLKGLYEF
FT                   FGPQIRSLGNSARIVVLGTTPELIEDIDEHIVQRALEGFTRSVAKELRDGATAQLVYVH
FT                   PKASTGASGLASTLRFLLSGKSAYVDAQVIRITDKDAEAPADWDKPLAGKVALVTGAAR
FT                   GIGATIAEVLSRDGAHVIAADIPAAGEALSEVANKVGGTALPLDVTAPDAGAKIAELVK
FT                   SRHSGLDIVVNNAGITRDKLLANMDEGKWNSVMAVNLKAPKQLVDDLLAAGALNEGGSV
FT                   VDVSSIAGIAGNRGQTNYGATKAGVIGIVDAYTSVLAEKNITINAVAPGFIETAMTAAI
FT                   PLATRQAGRLMNSLQQGGQTVDVAETISYFAAPASAAVTGNVVRVCGQSLLGA"
     atgcctgatg cacccagcac agacttctac gcagcgttcg tgaagtcggg ccccggctcc        60
     ttcctggcca gccgtctcgg cctcccgcag cccccgtcgc tgcgccgcta ccagcccggt       120
     aagcccgccc tcgccggccc cgtcctgctc ggcggcagcg gccgcctggt cgagccggtg       180
     cgcgagctgc tcgccgacta cgacctggtg gtcaacaacg gcggcgcccg cggcgccgag       240
     aagctcggtg gcgccgtctt cgatgccacc ggcatcacct ccatcgacga tctcaagggc       300
     ttgtacgagt tcttcggccc gcagatccgc tcgctgggca acagcgcccg catcgtggtg       360
     ctgggcacca cgcccgagct gatcgaggat atcgacgagc acatcgtcca gcgcgccctc       420
     gagggcttca cccgctcggt ggccaaggag ctgcgtgacg gtgccaccgc ccagctggtg       480
     tacgtgcacc cgaaggcctc gaccggcgcc tccggcctgg cctcgacgct gcgtttcctg       540
     ctctcgggta agtcggcgta cgtcgacgcg caggtcatcc ggatcaccga caaggacgcc       600
     gaagcgcccg ccgactggga caagccgctc gccggcaagg tcgccctcgt gaccggtgcc       660
     gcccgaggca tcggcgccac gatcgccgag gtgctctcgc gcgacggtgc gcatgtgatc       720
     gccgccgata tccccgccgc cggcgaggcc ctgtccgagg tcgccaacaa ggtgggcggc       780
     accgcgctgc cgctcgacgt gaccgccccc gatgcgggcg cgaagatcgc cgagctggtc       840
     aagtcccgcc acagcggcct cgacatcgtg gtcaacaacg ccggcatcac ccgcgacaag       900
     ctgctggcca acatggacga gggcaagtgg aactcggtca tggccgtcaa tctcaaggcc       960
     ccgaagcagc tggtggacga cctgctcgcc gccggtgcgc tgaacgaggg cggctccgtg      1020
     gtcgatgtct cgtcgatcgc cggtatcgcc ggtaaccgcg gacagaccaa ctacggcgct      1080
     accaaggccg gcgtgatcgg catcgtcgat gcgtacacct cggtgctcgc ggagaagaac      1140
     atcaccatca acgccgtggc ccccggtttc atcgagaccg cgatgaccgc cgcgatcccc      1200
     ctggcaaccc gccaggccgg ccgactgatg aactcgctgc agcagggcgg ccagaccgtc      1260
     gacgtcgcgg agaccatctc gtacttcgcc gcgcccgcgt cggcagccgt gaccggcaac      1320
     gtcgtgcgcg tgtgcggtca gagcctgctg ggagcctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page