(data stored in ACNUC1104 zone)

EMBL: CP001966.PE419

CP001966.PE419       Location/Qualifiers
FT   CDS_pept        complement(453967..455967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0432"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="KEGG: mab:MAB_4762 hypothetical protein; TIGRFAM:
FT                   YhgE/Pip C-terminal domain protein; YhgE/Pip N-terminal
FT                   domain protein; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77073"
FT                   /db_xref="GOA:D5URM0"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM0"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADG77073.1"
FT                   /translation="MSDKKSPKRSNTVPIAAGLAFGSEIKRFGRSRMTRAAIVVLMLLP
FT                   LVYGALYLWAFWDPFGNVNKMPVALVNADKGTIVKDQKINAGAEVEKSLKDDKSLDWNI
FT                   VSPAEARQGVKDGTYYFMLELPENFSSAIASPMTGKPEKAQLRAVYNDANNYISSTIGQ
FT                   TAMAQVLNAVSTRVSGQAVNQVLSMMITAGAGIEQAADGAGKLADGLVTANDGAAKLAD
FT                   GLATAKTGSAQLKTGSQQLSDGINQATDPILAVTRALSGLGGNTAELQQSATALVEAAD
FT                   KAGVFVKTQDTALAGIDAAIRQLAASPDPAARQAADGLRAIRGQLAQASVTEQTKQQII
FT                   AAQNGAIALTEQLRTPGSPLQTVLSKVGGTGDDLTAKLTQLRDGAAQVAAGNAQLDNGI
FT                   TQLSSGAGQLATGTVQLKDGSRELATKLGEGAQSVPKWSQEQTSQVASTIGGPVQLDST
FT                   HENRAPNFGTGMAPFFLTLALFFGALVLWMVFRPLQNRAIAAEVLAIRVVMASYLPAAA
FT                   IALCQAVILYCVVRFALGLEVAHPVGMFLFMLGVSLAFVAFTQAVNALVGPAVGRVLIM
FT                   ALLMLQLVSSGGMYPVETTARPFQVLHKYDPMTYGVNGLRQLVSGGIDHRLWQAVAVLV
FT                   FLWVVSVTVSCLSARRNRLWNLDRLMPAIKI"
     atgtccgaca agaagtcccc gaagcggagc aacaccgttc cgatcgccgc cggcctcgcc        60
     ttcggctccg agatcaagcg cttcggccgc agccggatga cgcgcgccgc gatcgtggtg       120
     ctcatgctgc tgccgctggt gtacggcgcg ctgtacctgt gggccttctg ggacccgttc       180
     ggcaacgtca acaagatgcc ggtggcgctg gtgaacgccg acaagggcac tatcgtcaag       240
     gatcagaaga tcaacgcggg cgccgaggtc gagaagtcgc tcaaggacga caagagcctg       300
     gactggaaca tcgtctcgcc ggcggaggcg cggcagggag tcaaggacgg cacgtactac       360
     ttcatgctgg agctgccgga gaacttctcc tcggcgatcg cctcgccgat gacggggaag       420
     cccgagaagg cgcagctgcg ggccgtctac aacgatgcca acaactacat cagctcgacc       480
     atcggacaga ccgcgatggc gcaggtgctc aacgcggtct cgaccagggt gtccgggcag       540
     gccgtcaacc aggtgctgtc catgatgatc acggccggag cggggatcga gcaggccgcc       600
     gacggggcgg ggaagctggc cgacgggctg gtgaccgcga acgacggtgc cgccaagctc       660
     gccgacggcc tggcgactgc gaaaacggga tcggcccagt tgaagacggg gtcgcagcag       720
     ctctcggacg gcatcaacca ggccaccgat ccgatcctcg cggtgactcg tgcgctctcc       780
     ggcctgggtg ggaacaccgc cgagttgcag cagagcgcta cggcattggt cgaggccgcc       840
     gataaggccg gggtgttcgt caagacgcag gacacggcgc tcgccggtat cgatgccgcg       900
     atccgtcagc tcgccgcgag ccccgaccca gctgcccgac aggccgcgga cggcctacgc       960
     gcgatacgcg ggcagctggc ccaggcgtcg gtgaccgagc agacgaaaca gcagatcatc      1020
     gccgcccaga acggggcgat cgcgctcacc gaacagctgc gcaccccggg cagcccgctc      1080
     cagaccgtac tgtcgaaggt gggcggcacg ggcgacgatc tgaccgccaa gctcacccag      1140
     ttgcgcgacg gtgccgccca ggtggccgcc ggtaacgccc agctggacaa cggcatcacg      1200
     cagctctcgt cgggcgccgg ccagctcgca acgggcaccg tgcaactgaa ggacggcagc      1260
     cgggagctcg cgacgaagct cggggaaggg gcgcagtccg tcccgaagtg gtcgcaggag      1320
     cagacctccc aggtggcttc gaccatcggc ggcccggtgc agctcgactc gacgcacgag      1380
     aaccgggccc cgaacttcgg taccggtatg gcgccgttct tcctcacgct cgcattgttc      1440
     ttcggggcgc tcgtgctgtg gatggtgttc cggcccttgc agaaccgcgc catcgcggcg      1500
     gaggtgctgg cgatccgggt ggtgatggcg agctatctcc cggcggcggc gatcgcgctg      1560
     tgccaggccg tgatcctgta ctgcgtggtg cggttcgccc tcggactgga ggtcgcccac      1620
     ccggtgggca tgttcttgtt catgttgggc gtctccctcg ccttcgtggc gttcacccag      1680
     gcggtgaacg ccctcgtggg gccggcggtg ggccgcgtgc tgatcatggc gctgctcatg      1740
     ctgcaactgg tgagttccgg cggcatgtat ccggtggaga ccaccgcccg acccttccag      1800
     gtgctgcaca agtacgaccc gatgacctat ggcgtgaatg gattgcgcca gttggtctcc      1860
     ggcggaatcg accaccggct ctggcaggcg gtcgccgtgt tggtgttcct gtgggtcgtc      1920
     tccgtgaccg tctcgtgcct ctccgcgaga cggaaccggt tgtggaacct cgaccggttg      1980
     atgcccgcga tcaagatctg a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page