(data stored in ACNUC1104 zone)

EMBL: CP001966.PE42

CP001966.PE42        Location/Qualifiers
FT   CDS_pept        44811..45920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A1951 membrane-anchored cell
FT                   surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76696"
FT                   /db_xref="GOA:D5UPS8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76696.1"
FT                   /translation="MRTAVAATVGAAWAVSGTALIAVLIAIAAGGATYALTAPSPAPAA
FT                   APATTTGTSNDENVRVALKAADDSRTIFGLLSNAVTSSSSGLSAAMSGVPQIFDSVDTA
FT                   RAGAEQVAAGLEETATTQNALNEVSQSAGAWANTLDQVEGISGLSVAVRSSSVQLRKQL
FT                   IDNPTPGSEDTVAQLDQVLAATDGLKTLESVDQLKGSLRSLTSLSDRSATALESARSSA
FT                   RQLRDGLTTISRARPNAESAVGNLSTGMKQLGIALKSIDDQLALIQTRLRDETRDQVEP
FT                   VAAAAPAMDGSARIGWALFAAGIAGVLAYLLALVVHQRVRRVPAAQSPAPLADLARAIS
FT                   EIPTPSHGFPRPDTHNTDPWLPVQFAREK"
     gtgcgtaccg cggtcgctgc gaccgtcggt gcggcgtggg cggtatccgg gaccgcactc        60
     atcgccgtgc tcattgcgat cgcagccggc ggtgccacct acgcactcac cgcaccgtca       120
     ccggcgcccg ctgccgcgcc ggctaccacc acggggacga gcaacgacga gaacgtccgg       180
     gtggcgctca aggcggccga tgattcgcgc accatcttcg ggctgctgtc caacgcggtc       240
     acctcgtcgt cgtccggtct gtcggccgcg atgtccgggg ttccacagat cttcgacagc       300
     gtcgacacgg cccgggcggg cgccgagcag gtggccgcgg ggctggagga aacggccacc       360
     acccagaatg cactcaatga ggtctcgcaa tcggccggcg cctgggcgaa caccctcgac       420
     caagtcgagg gcatctcggg actgtcggtc gcggtgcgct ccagctcagt ccaactgcgc       480
     aaacaactga tcgacaatcc gactcccggg tccgaagaca cggtggcgca gctcgatcag       540
     gtgctcgcgg ccaccgatgg cttgaagacc ttggaatccg tcgaccagct caagggatcg       600
     ctacgctcgc tgacgtcgct ctcggaccgg tccgcgacgg cactggaatc ggcgcgcagc       660
     tcggcgcggc agctccgcga cggcctcacc accatctcgc gagcccggcc gaacgccgaa       720
     tcggcggtgg gcaacctgtc caccggtatg aagcagctcg gcatcgcgct caaatccatc       780
     gacgatcagc tcgcgctcat ccagacccgg cttcgcgacg agacgcgcga tcaggtggag       840
     ccggtggccg cagcggcacc ggcgatggac ggttccgcgc gtatcggctg ggcgctgttc       900
     gccgccggta tcgcgggtgt tctcgcctat ctcctcgcgc tggtcgtcca tcagcgggtg       960
     cgccgggttc cggccgccca gtccccggcg ccgttggccg acctggcccg cgccatcagc      1020
     gagatcccca cgccctcaca cggattcccg cggccggaca cccacaacac cgatccgtgg      1080
     ttgccggtgc agttcgcccg cgagaagtag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page