(data stored in ACNUC1104 zone)

EMBL: CP001966.PE420

CP001966.PE420       Location/Qualifiers
FT   CDS_pept        complement(455973..456641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2368c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77074"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM1"
FT                   /inference="similar to AA sequence:KEGG:MAP2368c"
FT                   /protein_id="ADG77074.1"
FT                   /translation="MDDDQPNDVQLTAVNIGVDGEHGPLFQGIDLEFGPGLHAVQMPAG
FT                   RDQDALLLTLAGRLKPTHGTVDALGATSPGEIRKKCAIAAFADIDELDESVSVETVLSE
FT                   QRRWLAPWYSMVPLSAGRLEMDQVFGELDRPEPKTPIVELTDLQLFLLRITLALLGNRP
FT                   ILIVGDLEQVRDNPGRADAVQRLGAIATRYTVIVGVTNPLGGTAPQHTLHDRRALTRKD
FT                   "
     atggacgatg accagccgaa cgacgtgcaa ctcacggcgg tgaacatcgg ggtcgacgga        60
     gagcacggcc cgttgttcca gggcatcgat ctggagttcg gccccggcct gcacgcggtg       120
     cagatgcccg cggggcgcga ccaggacgcg ctgctgctca cgctcgccgg ccggctcaag       180
     cccacgcacg gcaccgtcga cgccctgggc gcgaccagcc cgggcgagat ccgcaagaag       240
     tgcgccatcg ccgctttcgc ggacatcgac gaactggacg agtcggtctc cgtcgagacc       300
     gtgctgtcgg agcagcggcg ctggctggcg ccgtggtatt cgatggtgcc gctgagcgcc       360
     ggccggctgg agatggacca ggtgttcggc gagctggacc gccccgaacc gaagacgccc       420
     atcgtcgagc tcaccgattt gcagctgttc ctgttgcgga tcaccctggc cctgttgggg       480
     aaccggccga ttctcatcgt cggtgatctg gaacaggtcc gcgacaatcc cggtcgcgcc       540
     gacgccgtgc agcgcctcgg cgccatcgcg acccgctaca ccgtgatcgt cggggtcacc       600
     aaccccctcg gcggcaccgc accgcagcac accctgcacg accgccgcgc gctcacccgg       660
     aaggactga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page