(data stored in ACNUC1104 zone)

EMBL: CP001966.PE423

CP001966.PE423       Location/Qualifiers
FT   CDS_pept        complement(459505..460275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0436"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="KEGG: rop:ROP_15710 putative endonuclease IV; PFAM:
FT                   Xylose isomerase domain protein TIM barrel; SMART: AP
FT                   endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77077"
FT                   /db_xref="GOA:D5URM4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADG77077.1"
FT                   /translation="MRIGAHVRSDTHPVETAESLGVDVIQMFVADPQSWKKPEPHPQTQ
FT                   ALRDSPLEIVVHSAYVINVASLNNRLRMPSRKAVEQQAAAAADLGAFGLVVHGGHLRDG
FT                   EDLQGGIDNWRKLFTRQEEKGGFGVPILIENTAGGDGAIARQLETIDRLWDAVGDQGAG
FT                   FCLDTCHAWAGGEELLGIVERVLAITGRIDLVHLNNSRDEFDSARDRHANLQDGTIDPD
FT                   LLADVARAADAPVILETPADGLADDVAYLKEALL"
     atgcgaatcg gtgcccacgt ccgcagcgac acccaccccg tcgagacggc ggagagcctc        60
     ggcgtggacg tgatccaaat gttcgtcgcg gacccacaga gctggaagaa gccggagccg       120
     cacccgcaaa cacaggcact cagggactcg ccgctcgaga tcgtcgtgca ctcggcgtac       180
     gtgatcaacg tggcgagtct gaacaaccgc ctgcgcatgc cgagccgcaa ggcggtcgaa       240
     cagcaggcgg ccgcggccgc cgacctcggt gccttcgggc tcgtggtgca cggcggccac       300
     ctgcgcgacg gcgaagacct gcagggcgga atcgacaact ggcgcaagct ctttacccgc       360
     caggaggaga agggcggctt cggcgtgccg atcctcatcg agaacaccgc gggcggcgac       420
     ggcgccatcg cgcggcagtt ggagaccatt gaccggctct gggatgcggt gggcgatcag       480
     ggcgccggtt tctgcctgga cacctgccac gcctgggcgg gcggcgaaga gttgctgggc       540
     atcgtcgagc gagtgctggc gatcaccggc cggatcgacc tggtgcacct gaacaactcg       600
     cgcgacgagt tcgattcagc acgggaccgg cacgccaacc tgcaggacgg caccatcgac       660
     cccgacctgc tggcggatgt ggcgcgggcc gccgatgccc cggtcattct ggagacgccg       720
     gccgacggcc tggccgacga tgtggcctat ctcaaggagg cactgctgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page