(data stored in ACNUC1104 zone)

EMBL: CP001966.PE426

CP001966.PE426       Location/Qualifiers
FT   CDS_pept        463433..463975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0439"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aau:AAur_0986
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77080"
FT                   /db_xref="GOA:D5URM7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77080.1"
FT                   /translation="MPPPPAARAKLLDAYVRILIEQGERAATLEAVAAEAGVSKGGLLY
FT                   HFGSKDALVEGLIGRLNELVEQDVELMRAAPEGAVDYYVRTSNYADTPLDRTIVAVLRL
FT                   SQVANTRAQEAIQAMQQRWLETLVEQVPDEAAARAVILMGDGLYYNAALSGGRHVATDE
FT                   QIEELLALVRHMLDAPR"
     gtgccgcccc ctcccgccgc ccgcgccaaa ctgctcgatg cctatgtgcg catcctgatc        60
     gaacagggcg aacgtgccgc gaccctcgag gccgtggccg ccgaggccgg cgtcagtaag       120
     ggcggtctgc tgtaccactt cggttctaag gacgccctgg tcgagggact gatcggccgg       180
     ctgaacgagc tggtcgaaca ggacgtcgag ctgatgcgcg cagctcccga gggcgccgtg       240
     gactactacg tccgcacctc gaactacgcc gatacgccgc tcgatcggac catcgtcgcc       300
     gtgctgcggc tgagccaggt ggccaacact cgtgcccagg aggcgatcca ggccatgcag       360
     cagcgctggc tggagacgct cgtcgagcag gtgcccgacg aggccgccgc gcgcgcggta       420
     atcctcatgg gcgacgggct gtactacaac gccgccctca gcggcggccg gcatgtggcc       480
     accgacgaac agatcgagga gctgcttgcg ctggtgcggc acatgctcga cgccccgcgg       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page