(data stored in ACNUC1104 zone)

EMBL: CP001966.PE430

CP001966.PE430       Location/Qualifiers
FT   CDS_pept        466942..467712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0443"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ckp:ckrop_0178 putative short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77084"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URN1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77084.1"
FT                   /translation="MPSIFISGGASGIGRATALRFLSEGWTVGVYDVNQAALDELTAEH
FT                   PQIVTGILDVRDFGQWEAALADFATHTGGTLTVLDNNAGVLFSGDLDEVTPEQIKLQID
FT                   IDALGVTYGAKAALPYLTGVEGAHLVNISSASAIYGQPGIATYSAAKFYVSGFTEALEL
FT                   EWEKHGIRVVAIWPLWAKTALAETDAKSTRTLGVNITPEEVAEQVWNSVHPGVQVPFLP
FT                   RVHYSVGTLTTLLSNSSKFAPRSVVRLINRFTSQ"
     atgccatcga tcttcatctc cggcggtgct tccggcatcg gccgtgccac tgccctgcgt        60
     ttcctgtccg agggatggac cgtgggcgtg tacgacgtca atcaggccgc gctcgacgag       120
     ctcacggcag agcatccgca gatcgtcacc ggcatcctcg atgtgcgcga cttcgggcag       180
     tgggaggccg cgctcgccga tttcgccacg cacaccggcg gcaccctcac agtgctcgac       240
     aacaatgcgg gggtgctgtt cagcggagac ctcgatgagg tcacacccga gcagatcaag       300
     ctgcagatcg acatcgacgc gttgggcgtc acgtacggcg ccaaggccgc gctgccctac       360
     ctcacggggg tcgagggtgc gcatctggtg aacatcagct ccgcctcggc catctacggc       420
     cagccgggta tcgccaccta cagcgccgcg aagttctacg tctccggttt caccgaggcg       480
     ctcgaactcg aatgggagaa gcacggcatc cgggtcgtcg cgatctggcc gctctgggcc       540
     aagaccgcgc tcgccgagac cgatgcgaag agcactcgca ccctcggcgt gaacatcacg       600
     cccgaggagg tggccgagca ggtgtggaac tctgtacacc ctggtgtgca ggtgcccttc       660
     ctgccgcgcg tgcactattc cgtcggaact ctcaccaccc tgctgtccaa ttcgagtaaa       720
     ttcgcaccgc ggtccgtggt gcgcctgatc aaccggttca ccagccagta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page