(data stored in ACNUC1104 zone)

EMBL: CP001966.PE432

CP001966.PE432       Location/Qualifiers
FT   CDS_pept        complement(469526..470026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77086"
FT                   /db_xref="UniProtKB/TrEMBL:D5US19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77086.1"
FT                   /translation="MGWNVSILHIAAPGPDAGGSLILGADRRTDPAGDDDAWARAVDGG
FT                   TVVASGDILDPHAVERFAAHTGVPVTSVMIGSTGGAYGIEVYRDGALVRRVGETDDGFS
FT                   DQVGPPLAEESLPAVLAEKHSEDRYFALFAAVAGITDLSFLADAEFARVITPELTFGPE
FT                   GLD"
     atgggttgga acgtatcgat actgcacatc gcggcaccgg gtccggacgc cggcggatca        60
     ctcatcttgg gtgccgaccg gcggaccgat cccgcgggcg acgacgacgc ctgggcgcgc       120
     gccgtcgacg gggggacggt ggtcgcgagc ggcgatatcc tcgacccgca cgcggtcgaa       180
     cgattcgcgg cgcacaccgg cgtgccggtg accagcgtga tgatcggaag caccggaggt       240
     gcctacggca tcgaggtcta ccgcgacggg gcgttggtgc gccgggtcgg cgagacggac       300
     gatgggttct ccgatcaggt cggccctccg ctcgcggagg agtcattgcc cgccgtgctg       360
     gccgagaagc attccgagga ccgatatttc gccttgttcg ccgcggtcgc gggcatcacg       420
     gatctgagct tcctcgccga tgccgagttc gcccgggtga tcacgcccga gctcactttc       480
     ggtcccgagg gtctcgactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page