(data stored in ACNUC1104 zone)

EMBL: CP001966.PE438

CP001966.PE438       Location/Qualifiers
FT   CDS_pept        complement(475788..476099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77092"
FT                   /db_xref="UniProtKB/TrEMBL:D5US25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77092.1"
FT                   /translation="MSDLSWPAARIVGRTAIRGYLELGDSHLRFRPAGLAAKMQGAPFA
FT                   VQLRHLAGAGVVETTGLLRRGKHRLCVTLGDASEQVFDVSRPDEVAAAIRERIPGGAA"
     atgagcgacc tgagctggcc cgccgcccgg atcgtgggcc gcacggccat ccgcggatac        60
     ctcgaactgg gcgacagtca cctcaggttc cggcccgcgg gtctcgccgc gaagatgcag       120
     ggagcgcctt tcgccgtgca actgcgccat ctcgccggcg cgggagtcgt cgagaccacg       180
     ggcctattgc gtcgcggcaa gcaccggcta tgcgtcaccc tgggcgatgc gtccgagcag       240
     gtattcgacg tatcgcggcc cgacgaggtg gccgcggcca tccgcgagcg gatcccgggc       300
     ggagcggcgt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page