(data stored in ACNUC1104 zone)

EMBL: CP001966.PE439

CP001966.PE439       Location/Qualifiers
FT   CDS_pept        476177..476542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa26690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77093"
FT                   /db_xref="GOA:D5US26"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D5US26"
FT                   /inference="similar to AA sequence:KEGG:nfa26690"
FT                   /protein_id="ADG77093.1"
FT                   /translation="MVYLGPIILLLWVAALIDVIVADEYRVRHLPKFGWLIVVILIPLA
FT                   GSLIWFLLGRPVGAVNSAPTRTTGFPEYERRHRHIAQYPDDDDDFLRQCRERAEEQRRK
FT                   AKGLDARNLGEEPDPKD"
     atggtgtact tggggcccat cattctgttg ctgtgggtgg ccgcactcat cgacgtgatc        60
     gtcgcggacg aataccgcgt gcgtcatctc ccgaagttcg gctggctgat cgtcgtgatc       120
     ctgatcccgc tcgccggctc gctgatctgg ttcctgctgg ggcgccctgt cggggcggtg       180
     aacagcgcgc cgaccaggac taccggattt ccggagtacg agcgccgtca tcggcacatc       240
     gcccagtacc ccgatgacga cgacgacttc ctgcggcagt gccgggaacg cgccgaggag       300
     cagcgtcgga aggccaaggg gctcgatgcc cgcaatctgg gcgaggaacc ggaccccaag       360
     gactga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page