(data stored in ACNUC1104 zone)

EMBL: CP001966.PE44

CP001966.PE44        Location/Qualifiers
FT   CDS_pept        complement(47409..48338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0044"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rer:RER_48540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76698"
FT                   /db_xref="GOA:D5UPT0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT0"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADG76698.1"
FT                   /translation="MSRALVIGCGGTIGGAWTMAALAALADQLDWDPREAAVLQGTSAG
FT                   AEIVTLLSGGYSPHELVSMQEERSADPVLTRHLAATPGSLPRIPISLPSQPSTLWSRTG
FT                   GHAPLTGVAPRGRGDARWLQELADSVLGVSAPVPERARLVAYEPATGERVAFGAAGAPS
FT                   ATAGEALRASWAIPAWMPPVTISGRTFVDGGAASTASLDLIAPDDADEIYAIVSMASAP
FT                   GVRGPGIGGLMEQALLRRPMSSVFWREVAVARARGQKVTVIAPDAADLAGLGANFMARG
FT                   KRAAAFAAAQRTAPQTVRRALSGEAVPR"
     gtgagccgcg cactcgtcat cggctgcggc ggcaccatcg gcggcgcctg gaccatggcc        60
     gcgctcgcgg cgctcgccga tcagctggac tgggaccctc gcgaggccgc tgtgctccag       120
     ggcacctcgg ccggcgccga gatcgtaacc ctgctctccg gcgggtattc gccgcacgag       180
     ctggtctcga tgcaagagga gcgcagtgcc gatcccgtgc tcacccggca tctggcggcg       240
     acacccggtt cgttgccccg gatcccgatc tcactgccgt cgcagccctc caccctgtgg       300
     agccgcaccg gcgggcacgc tccgctgacc ggtgtggcac cacgcggacg cggtgacgca       360
     cgctggctgc aggaactcgc ggattccgtt ctgggcgtaa gtgccccggt acccgagcgc       420
     gcgcggctcg tggcctacga acccgccacc ggtgagcggg tggccttcgg cgcggcgggc       480
     gcaccgtcgg ccacggcggg cgaggcactg cgcgcctcgt gggccattcc ggcctggatg       540
     ccacccgtca cgatcagcgg gcgcaccttc gtcgacggcg gcgcggcctc gacggcctcg       600
     ctcgatctga tcgctcccga cgatgcggac gagatctacg cgatcgtctc catggcctcg       660
     gctccgggcg tccgcggtcc gggtatcggc ggcctgatgg agcaggcact gctgcgccgg       720
     ccgatgtctt cggtgttctg gcgtgaggtg gccgtggcac gggcccgggg acagaaggtt       780
     actgtgatcg cgcccgacgc tgccgatctc gccgggctcg gcgcgaactt catggcccgt       840
     ggcaagcggg ccgcggcctt cgccgcggcg cagcggaccg caccgcagac ggtacgccgg       900
     gccctatccg gggaggcggt gccgcgatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page