(data stored in ACNUC1104 zone)

EMBL: CP001966.PE440

CP001966.PE440       Location/Qualifiers
FT   CDS_pept        476594..477640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0392c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77094"
FT                   /db_xref="GOA:D5US27"
FT                   /db_xref="UniProtKB/TrEMBL:D5US27"
FT                   /inference="similar to AA sequence:KEGG:MAB_0392c"
FT                   /protein_id="ADG77094.1"
FT                   /translation="MTGDEAEALRRRIDEQAVPLELIPIAPLGFRDLVVGAARALRTNP
FT                   RIMFGLTAVVVGVMGLVALIAQLSLVPGARATGVARADEDARQVLAALGVGSGVQVANS
FT                   ALSMVGTLLVTGMVTVVVARSVLRHRTRTAMAWSVAGRRLPALALLGVIEIGMILAPLT
FT                   AAVAAAILVAIAVGPSGVAGYVMLIGLLTVVAVFAMWPLFAMAAPAVVLERCGPVAALS
FT                   RAVDLIRPGYLRLLWRLLLVSATSYAVGLLIWIPFILLGRALSHADRGLVPSLFLVVGA
FT                   AIGQTVTLPFLAAMNTLLYTDQRIRLEEVAAELQRVADEAPSPDVAMVWQVTRPGADVA
FT                   PGTRSESQ"
     gtgaccggcg acgaagcgga ggccttgcgc cgccggatcg atgagcaagc ggtgccgttg        60
     gagttgatac cgatcgctcc actcggcttc cgtgatctcg tcgtgggtgc ggctcgcgcg       120
     ctgcgcacca accccaggat catgttcggc ctcaccgccg tggtggtcgg tgtgatgggg       180
     ctggtcgcgc tgatcgcgca gctctcgctg gttccggggg cgcgcgcgac aggcgtggcc       240
     cgggccgatg aggatgcccg gcaggtgttg gccgcgctcg gcgtcgggtc gggggtgcag       300
     gtcgccaact ccgcgttgag catggtgggc acgctcctgg tgaccggcat ggtcacggtg       360
     gtcgtggcgc ggtccgtgct gcggcaccgc acccgcacgg cgatggcgtg gtcggtggcg       420
     ggccgccggc tgcccgcgct cgccctgctc ggggtgatcg agatcggcat gatcctggcc       480
     ccgctgacgg cggccgtcgc cgccgcgatc ctggtcgcga tcgcagtcgg tccgtccggt       540
     gtggcggggt acgtgatgct catcgggctg ctgaccgtgg tcgcggtgtt cgcgatgtgg       600
     ccgctgttcg cgatggcggc gcccgccgtc gtgctcgaac ggtgcggacc cgtcgcggct       660
     ctcagccgcg cggtcgacct gatccggccc ggatacctgc ggctgctgtg gcggctgctc       720
     ctggtatccg cgaccagcta cgcggtggga ctgctgatct ggatcccgtt catcctgctc       780
     gggcgcgcgc tctctcacgc ggaccgcggc ctggtgccgt ccttgttcct ggtcgtcggc       840
     gcagcgatcg gccagaccgt caccctgccc ttcctggctg cgatgaacac gctgctgtac       900
     accgaccaga ggattcgtct cgaagaggtc gcagccgagc tgcagcgggt ggccgatgag       960
     gcgccgagcc ccgacgtcgc catggtgtgg caggtcacac gccccggtgc cgatgtggca      1020
     cccggaacgc gtagtgaatc tcagtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page