(data stored in ACNUC1104 zone)

EMBL: CP001966.PE442

CP001966.PE442       Location/Qualifiers
FT   CDS_pept        479481..480554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0455"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="KEGG: cjk:jk0553 putative secreted protein; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART: Animal
FT                   peptidoglycan recognition protein PGRP"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77096"
FT                   /db_xref="GOA:D5US29"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D5US29"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADG77096.1"
FT                   /translation="MRISRRSVMLAGATAAAITAGTGRRAAAAPAQAAGGAEYVSIDLT
FT                   RTRGQRVAIRVTLPGGRSVEIAVRRTTHGRDDRPLPNTSELIALPPDTLDLEVITDAGI
FT                   ALTPTRYRIATAPNFQTPVATHYGWGFPVVTRTGWGADPALQTWGDPEYTPAQVITVHH
FT                   TAQPRGDEYLDYRDAVRSIYRFHASPASDGGRGWGDIGYHLIIDPNGVIYAGRDTGADA
FT                   PVFAPGTSTLRPGAPVVTAGHVYQANSGNIGVCVIGDFTGSQPTPAARASLVQVLAALC
FT                   RQLGLNPQAAVRYVNPNNAVRATSWAISGHRDWAKIAGPTECPGDELWALLPALRSATE
FT                   FRASDDGAVPRSPVPGA"
     atgcggattt cccgacgttc ggtgatgctg gcgggtgcca cggcggcggc gatcacggcg        60
     ggaacggggc gcagagccgc agcggcaccg gcacaggccg cgggtggggc agagtacgtc       120
     tcgatcgacc tcaccagaac ccgaggtcag cgggtcgcca tcagagtcac tcttcccggg       180
     ggacgcagcg tcgagatcgc cgtccgccga acgacgcacg gccgtgacga ccggccgctg       240
     ccgaacacct cggagctgat cgccctccct ccggacacgc tcgatctgga ggtgatcacc       300
     gacgccggca tcgcgctgac accgacgcgc taccggatcg cgaccgcgcc gaacttccag       360
     acgcccgtcg ccacgcatta cggctggggc tttcccgtgg tgacgcggac cggctggggc       420
     gcggacccgg cgctccagac ctggggcgat ccggagtaca cccctgccca ggtgatcacc       480
     gtgcaccata cggcgcagcc gcggggcgac gaatacctcg actaccgcga tgcggtccgc       540
     tcgatctacc gcttccacgc ctctccggct tccgatggcg gccggggatg gggcgacatc       600
     ggctaccacc tgatcatcga tcccaatggc gtgatctacg cgggccgcga caccggtgcc       660
     gacgccccgg tcttcgcgcc cggaacgtcg acgctgcgtc cgggtgcgcc ggtcgtaacc       720
     gccgggcacg tctaccaggc caacagtggc aacatcggtg tctgcgtcat cggggacttc       780
     accggctctc agcccacgcc cgcagcgcgg gcgtcgctgg tccaggtgct cgcggccctg       840
     tgtcgccagc tgggactgaa tccgcaagcc gcggtccggt acgtgaatcc gaacaacgcc       900
     gtgcgcgcga cctcatgggc gattagcggt caccgagact gggcgaagat cgccggaccc       960
     accgaatgcc ccggtgacga gctgtgggct ctgcttcccg cactgcgtag tgcgaccgag      1020
     ttccgggctt ccgacgacgg tgcggtcccc cgctctccgg tgcccggagc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page