(data stored in ACNUC1104 zone)

EMBL: CP001966.PE445

CP001966.PE445       Location/Qualifiers
FT   CDS_pept        complement(482836..484209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0458"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   nfa:nfa12290 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77099"
FT                   /db_xref="GOA:D5US32"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D5US32"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG77099.1"
FT                   /translation="MTDAPLRRGLTARHIRFIALGSAIGTGLFYGSAKAIQAAGPSVLL
FT                   AYVIGGLVIYLVLRALGEMAVRNPQGSFGDYASSSLGPRAGFMTGWMYVFEMVFVCIAD
FT                   VTAFGTYMGLWFPHVPKWIWVLAVILFIGALNMMRVKVFGEVEFWLTMVKITAIVAMIF
FT                   GGIAVLIFGFGMHDTSRGVSNLWGDGGFFATGFLGFLSCFVLVVFAFGGSEIIGLTAAE
FT                   AEDPERTIPKAINTVPVRIGLFYVLALAVIMAVIPWNQISSESSPFVQIFQALGVEPAA
FT                   HVLNVVVITAAISAINSDIYGAGRMMFGMAQRGQAPTIMQKVSRNGVPWMTVVIMAAAL
FT                   LVGVVLNAAIPENVFVVIASIATFATVFVWLMILFSQYRQRTAMSADEQSALTFPVPLW
FT                   PYGQLIAIAFLLFVTVLMAFQPDTRVALIVGFVWLAFLAAAYAVWVAPKAAVRSGSER"
     gtgactgacg cacccctccg tcgcggactc accgcccggc acatccggtt catcgcgctg        60
     ggctcggcca tcggcaccgg cctgttctac gggtcggcga aggccatcca ggcggccggg       120
     ccatcggtac tgctggccta tgtgatcggc ggcctggtga tctacctggt gctgcgggcg       180
     ctgggcgaga tggcggtgcg caatccgcag ggctcgttcg gcgactacgc ctcgtcgagc       240
     ctggggccgc gggccgggtt catgacgggg tggatgtacg tcttcgagat ggtcttcgtg       300
     tgcatcgccg acgtcaccgc gttcggcacg tacatggggc tgtggttccc gcacgtgccg       360
     aagtggatct gggtactcgc cgtgatcctg ttcatcggcg cactgaacat gatgcgcgtc       420
     aaggtgttcg gcgaggtcga gttctggctg acgatggtga agatcaccgc gatcgtcgcc       480
     atgatcttcg gcggcatcgc ggtgctgatc ttcggcttcg gcatgcacga caccagccgg       540
     ggcgtgagca atctgtgggg cgacggcggc ttcttcgcca ccggcttcct cggcttcctg       600
     tcctgcttcg tgctggtggt gttcgccttc ggcggctcgg agatcatcgg gctcaccgcc       660
     gcggaggcag aagatcccga gcgcacgatc cccaaggcga tcaacacggt gccggtgcgt       720
     atcggcctgt tctacgtgct ggcgctggcc gtcatcatgg cggtgatccc gtggaaccag       780
     atcagcagcg agtcgagccc gttcgtccag atcttccagg cactcggcgt ggagcccgcc       840
     gctcacgtgc tcaacgtcgt ggtgatcacc gcggcgatct cggccatcaa cagcgatatc       900
     tacggcgccg gccggatgat gttcggcatg gctcagcgcg ggcaggcgcc cacaatcatg       960
     cagaaggtct cccgtaacgg cgttccctgg atgacggtgg tgatcatggc cgccgcgctg      1020
     ctggtgggcg tggtgctcaa cgccgccatc ccggagaacg tgttcgtggt gatcgcgtcg      1080
     atcgccacct tcgcgacggt cttcgtgtgg ctgatgatcc tgttctcgca ataccgccag      1140
     cgcacggcga tgtccgccga tgagcagtcg gcgctgacgt tccccgtgcc gctgtggccc      1200
     tacggccagc tgatcgccat cgcgttccta ctgttcgtca cggtgctgat ggcgttccag      1260
     ccggacaccc gggtggcgct gatcgtcggg ttcgtgtggc tcgccttcct cgccgccgca      1320
     tacgccgtgt gggtggcgcc gaaggccgca gtgcggtccg gttcggagcg ttag            1374
//

If you have problems or comments...

PBIL Back to PBIL home page