(data stored in ACNUC1104 zone)

EMBL: CP001966.PE447

CP001966.PE447       Location/Qualifiers
FT   CDS_pept        complement(484865..486556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0460"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: rop:ROP_55290
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77101"
FT                   /db_xref="GOA:D5US34"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D5US34"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADG77101.1"
FT                   /translation="MTDTDEHADHDHAAGVHSHSLSTISLGKWASRVVVGLLAVIGVAV
FT                   VIGVIALWPSQLRVSVPNAPESPTLYKGTVSEQVLGECDFSPRGNGQVSDTEPHPVSNP
FT                   DGGCLNSSVKITSGPDTNRWTQFSIGTMRVNFSSLPGQGPSSGSNGIDTSRPATPGTGQ
FT                   PDLTPGTKIMIAENGGGVAGAPSNYSFYDYSRGVSLWVWGLIFAAVIVAVAHWRGFRAL
FT                   VGLALSGVVIVLFALPSILDGHSAVWVALVASAVILYVVLYLAHGVSLRTSAALLGTLC
FT                   ALAVCAALAWAATVTTRVTGLSSDDATNLQAHASQLSISGVLLAGFVIGALGVLNDVTI
FT                   TQSSTTFELAKLSPKASRRRTFLSSMRVGRDHIASTVYTLVFAYVGSALPLLLLFSIAG
FT                   RPLGQVLTSDSVSVELVRSFVGGIGLALSVPLTTAIATLLAKPTRASVSPEAAQRYTHS
FT                   HPDADPSEIKVRQRRAAAPAVAEPALSAPAQAPAQQAPAPPATESPVTGQMPVQRPVRP
FT                   APPRPSEPIPAPPRPQPKPPVVPPAPPTQAPSEPEPRRRGRHAAPD"
     gtgacagaca ccgacgagca cgccgaccac gaccacgccg caggggtgca cagccactcg        60
     ctgagcacca tctcgctcgg caaatgggca tcacgcgtgg tcgtcggcct gctcgcggtg       120
     atcggggtgg ccgtggtgat cggcgtgatc gcactgtggc cttcgcagct ccgggtgagc       180
     gtgccgaacg cacccgaatc gcccaccctg tacaagggca ccgtgtccga acaggtgctg       240
     ggcgagtgcg atttcagccc gcgcggcaac ggtcaggtct ccgacaccga gccgcacccg       300
     gtctccaatc ccgacggtgg ctgcttgaac agttccgtga agatcaccag cggccccgac       360
     acgaacaggt ggacccagtt ctccatcggg acgatgcggg tcaatttcag ctcgcttccg       420
     ggacaggggc cctcgagcgg atccaacggc atcgacactt cgcgcccggc cacgcccggc       480
     acgggccagc ccgatctgac ccccggcacc aagatcatga tcgccgagaa cggcggcggg       540
     gtggccggcg cccccagcaa ttattcgttc tacgactact cacgcggcgt ctcgctgtgg       600
     gtgtggggac tgatcttcgc ggccgtgatc gtcgcagtgg cgcattggcg gggtttccgg       660
     gcactggtcg ggttggcgct ctcgggtgtg gtgatcgtgc tgttcgcgct gccctcgatc       720
     ctggatggac attccgccgt gtgggtggct ctggtcgcct cggcggtgat cctctacgtg       780
     gtgctgtacc tggcgcacgg tgtctccctg cgcacgtccg cggcgctact ggggaccttg       840
     tgcgccttgg cggtgtgcgc cgcgctggcc tgggcggcca cggtgaccac ccgggtcacc       900
     ggcctgagca gtgacgatgc cacgaatctc caggcgcacg cctcgcaact gtcgatctcg       960
     ggcgtgctgc tcgcgggctt cgtgatcggt gcgctcggtg tgctcaacga tgtgaccatc      1020
     acccagtcct cgaccacgtt cgagctggcc aagctctcgc cgaaggcctc gcgccgccgc      1080
     acgttcctct cgtccatgcg cgtgggccgc gaccacatcg cgtcgaccgt gtacacgctg      1140
     gtgttcgcct atgtggggtc ggcgctgccg ctgctgctgt tgttctcgat cgccgggcgg      1200
     ccgctgggcc aggttctcac ctcggactcc gtatcggtgg agctggtgcg gtcgttcgtc      1260
     ggcggcatcg gcctcgcgct gtctgttccg ctgaccaccg cgatcgcgac cctgctcgcc      1320
     aagcccaccc gagcatccgt gagccccgag gcggcgcagc ggtacacgca cagccacccc      1380
     gatgccgatc cttcggagat caaggtccgt cagcggcgtg ccgcggcccc ggcggtggcc      1440
     gagcccgcgc tgtccgcacc ggcacaggca ccggcacagc aggcaccggc accaccggcg      1500
     acggagagcc cggtcaccgg ccagatgccg gtgcaacgtc ccgttcggcc cgcaccgccc      1560
     cgtccatcgg aaccgattcc cgcgccgccg cgcccacagc cgaaaccccc ggtcgtacca      1620
     ccggccccgc ccacgcaggc gccgtccgag cccgagccgc gtcggcgcgg ccgccatgcg      1680
     gccccggact ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page