(data stored in ACNUC1104 zone)

EMBL: CP001966.PE448

CP001966.PE448       Location/Qualifiers
FT   CDS_pept        complement(486567..487823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0461"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rer:RER_13320 alanine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77102"
FT                   /db_xref="GOA:D5US35"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5US35"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG77102.1"
FT                   /translation="MSRPHVPHIRTELKPLEQSAKLQNVLYEIRGPVVAQAARLEAQGH
FT                   RILKLNIGNPATFGFEAPDSIVRDMIHALPTSQGYSESQGIASARRAVVTRYEEVPDFP
FT                   YFDIGDVYLGNGVSELITMTLQALLNNGDEVLIPAPDYPLWTAMTSLSGGTPVHYLCDE
FT                   DNGWNPSVEDIEAKITPRTKAIVVINPNNPTGAVYSRETLQQIVEVARKHSLLVLADEI
FT                   YDRILYDDAQHISIAELAPDLLVCTFNGLSKAYRVCGYRAGWMVLTGPKDHASGFIEGL
FT                   TLLASTRLCPNVPAQHAIQVALGGYQSINDLILPGGRLLEQRDVAFEKLNAIDGVSCVK
FT                   PQGALYAFPKLDPNVHEIRDDEQLVLDLLNQEKILLVQGTGFNWPTPDHLRVVTLPWAR
FT                   DLSEALDRFGNFLSSYKQK"
     atgagccgac cgcatgtgcc ccacatccgc accgaactca agccgctcga gcagtccgcc        60
     aagctgcaga acgtgctgta cgagatccgt ggacccgtgg tggcacaggc ggctcggctc       120
     gaggcgcagg ggcaccgcat cctcaagctg aacatcggca acccggcgac cttcggcttc       180
     gaagcgcccg actcgatcgt ccgcgacatg atccacgcgc tgcccacctc gcagggctac       240
     agcgagtcgc agggcatcgc ctccgcgcgg cgggccgtgg tgacccgcta cgaggaggtc       300
     cccgacttcc cctacttcga catcggcgac gtctacctcg gtaacggggt ctccgagctc       360
     atcaccatga cgctgcaggc gctgctcaac aacggcgacg aggtgctcat ccccgcgccc       420
     gactaccccc tgtggaccgc catgacgtcg ctctccggcg gcacccccgt gcactacctc       480
     tgcgacgagg acaacggctg gaacccgtcg gtcgaggata tcgaggcgaa gatcactccg       540
     cgcaccaagg cgatcgtggt gatcaacccg aataacccga cgggcgcggt gtactcgcgc       600
     gagacgctgc agcagatcgt cgaggtggcg cgcaagcact cgctgctcgt gctcgccgac       660
     gagatctacg accgcatcct ctacgacgac gcgcagcaca tctccatcgc cgaactcgcg       720
     cccgacctgc tggtctgcac gttcaacggc ctgtccaagg cgtaccgcgt gtgcggctac       780
     cgcgccggct ggatggtgct caccgggccc aaggaccacg cctccggctt catcgagggc       840
     ctgaccctcc tggcgtcgac ccgcctgtgc cccaacgtcc ccgcgcagca cgcgatccag       900
     gtggcgctcg gcggttacca gtcgatcaac gacctgatcc tccccggcgg acggctgctg       960
     gagcagcgcg acgtcgcgtt cgagaagttg aacgccatcg acggggtgag ctgcgtcaag      1020
     ccccagggcg cgctgtacgc cttcccgaag ctggacccga acgtgcacga gatccgcgac      1080
     gatgagcagc tggtgctcga tctgctcaac caggagaaga tcctgctggt ccagggcacc      1140
     ggtttcaatt ggcccacgcc cgaccatctg cgcgtggtga ccctcccctg ggcccgtgac      1200
     ctgtccgagg cgctcgaccg cttcggcaac ttcctgagtt cttataagca gaagtag         1257
//

If you have problems or comments...

PBIL Back to PBIL home page