(data stored in ACNUC1104 zone)

EMBL: CP001966.PE449

CP001966.PE449       Location/Qualifiers
FT   CDS_pept        complement(487870..488877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77103"
FT                   /db_xref="GOA:D5US36"
FT                   /db_xref="UniProtKB/TrEMBL:D5US36"
FT                   /inference="similar to AA sequence:KEGG:Mjls_0458"
FT                   /protein_id="ADG77103.1"
FT                   /translation="MSKNHATLAAVFAGLAIAIPLIVLLFTAPAAKGAPHDLPIGVVGP
FT                   EAAVTQVSDRLDEQQPGGFDVKAYASADELIAAAENREVYGGIVLGAQPRAITATGASP
FT                   VVAPLITQLANAAAQGRTVQVTDVAPPSVDDPRGAGFGSMVMPVFLSGMVLALSTVMIG
FT                   GHPKIVAAALPIGAAVVGAAAVGAAMWIGVLPGGFGAQWLAMSAGMLAIGATVAGLVQL
FT                   LGTKGIAPAALLFMLVGMPLAGIAAPPEFLPHVWGVLGQSLPIGATGTALRGAAFFAPD
FT                   ALIGAGAGAAFAVLGAWIVVGYGLLTIGVARHRAQPSGAPSGERTPDAAVATPA"
     atgagcaaga accacgccac gctggccgcg gtcttcgccg ggctggcgat cgctatcccg        60
     ctgatcgtgc tgctgttcac cgcacccgcc gcgaagggcg caccgcacga cctgccgatc       120
     ggcgtcgtcg gaccggaggc cgccgtcacg caggtctccg accggctcga cgaacagcag       180
     ccgggcggat tcgacgtgaa ggcctacgcc tcggccgacg aattgatcgc cgcggccgag       240
     aaccgtgagg tgtacggcgg catcgtcctc ggcgcgcagc cccgcgcgat caccgccacc       300
     ggagcgtccc ccgtggtggc tccgctcatc acccaactcg ccaacgccgc cgcgcagggc       360
     cgcaccgtgc aggtgaccga tgtcgcacca ccctcggtcg acgatccgcg gggagccggt       420
     ttcggttcga tggtgatgcc ggtgttcctc agcggcatgg tcctggcact gtccaccgtg       480
     atgatcggag gccatccgaa gatcgtcgcc gccgcgttgc cgatcggtgc cgcagtcgtg       540
     ggtgccgccg cggtgggcgc agcgatgtgg atcggtgtcc tgccaggcgg tttcggggcg       600
     cagtggctcg cgatgagcgc cggaatgctg gccatcggtg caacggtggc gggactggtg       660
     caactgctgg gaaccaaggg aatcgcccct gccgctctgc ttttcatgct cgtcggaatg       720
     cccctcgcgg gtatcgccgc gccgccggaa ttcctgccgc acgtgtgggg tgtactcggc       780
     cagagcctgc cgatcggtgc caccggcacc gcgctgcgcg gcgccgcgtt cttcgcaccc       840
     gacgccctga tcggcgcggg agccggggcc gctttcgccg tcctcggcgc ctggatcgtc       900
     gtgggctacg gcctgttgac gatcggcgtg gcccggcacc gggctcagcc gtccggcgca       960
     ccgtcgggcg agcgcacgcc ggacgcggcg gtggccaccc cggcctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page