(data stored in ACNUC1104 zone)

EMBL: CP001966.PE45

CP001966.PE45        Location/Qualifiers
FT   CDS_pept        complement(48335..49228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0045"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mab:MAB_1526 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76699"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG76699.1"
FT                   /translation="MTLLDRLLPIGGRRRPDLNGAVVVVTGGARGIGAATARLFAQQGA
FT                   RVWIGDIDPDVAHTTAQTIPGARAGYLDVTDRASWDTLLTEVTAAAGPVDVLVNNAGVM
FT                   PLGHFESEAEATTDLILDVNVRGMLNGMRATIPAMVHRGHGHVVNVASMAGMIPLPGMV
FT                   TYNASKFAALGASLGARREYDGTGVAVCAILPAAVRTELSSGAELGGALPTVDPEDVAA
FT                   AVVDTMRTRAARTSVPKWVAPGWSLVDAFVPEPVERLARRLAGDRRGLDLDADARRAYT
FT                   DRLDRHASAHAEGVAQ"
     atgacgcttc tcgaccggct actcccgatc ggcggcaggc gccgccccga cctgaacggg        60
     gcggtggtcg tcgtcacagg tggtgcgcgc ggcatcggag cggcgacggc ccggctgttc       120
     gcgcagcagg gcgcacgggt ctggatcggc gatatcgacc cggacgtggc gcacacgacc       180
     gctcagacga tccccggcgc ccgcgccggg tacctcgacg tgaccgaccg ggcctcgtgg       240
     gacaccctcc tcaccgaggt caccgccgca gcgggaccgg tggacgtgct cgtcaacaac       300
     gccggtgtga tgcctctcgg ccacttcgaa tccgaggccg aggccaccac cgatctgatc       360
     ctggacgtga acgtgcgcgg catgctcaac ggcatgcgcg cgacgatccc ggcgatggtg       420
     caccgcggac acggacacgt ggtgaacgtc gcgtcgatgg cgggcatgat cccgctcccc       480
     ggaatggtca cctacaacgc gagcaagttc gccgcactcg gcgcctccct cggcgcacgc       540
     cgcgagtacg acggcaccgg cgtcgcagtg tgcgcgatcc tgcccgccgc cgtccgcacc       600
     gagctctcat cgggcgccga gctcggcggc gcactcccca ccgtcgatcc ggaggacgtc       660
     gccgccgccg tggtcgacac gatgcgcacc cgggccgccc ggacatcggt gccgaaatgg       720
     gtcgcccccg gctggagcct ggtggatgcc ttcgtgcccg agccggtgga acgactcgcg       780
     cggcgcctcg ccggcgatcg gcgcggcctc gacctcgacg cggacgcccg ccgggcgtac       840
     accgaccggc tcgaccggca cgccagcgcg cacgccgagg gcgtcgccca gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page