(data stored in ACNUC1104 zone)

EMBL: CP001966.PE450

CP001966.PE450       Location/Qualifiers
FT   CDS_pept        488975..489556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0463"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcv:Bcav_3630
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77104"
FT                   /db_xref="GOA:D5US37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D5US37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77104.1"
FT                   /translation="MGTGRRAGASTAKADILEAARELFAEVGYDRATIRAIAARAGVDV
FT                   ALVSYYYGNKKGLFRGVMSMPVDPEAIFTAALDGPRDGVGERLLRAALTIWEGPETSEA
FT                   FRALLRAAADADEGAARTFGEFLSSVMIPTLTTHAGVGIETARVVASNLFGLAFLRYLI
FT                   AAPLFVAPSTEELIATYGAAVQRIIDADAG"
     atgggtacag gcaggcgggc gggagccagc accgcgaagg cggacatcct cgaggcggcg        60
     cgcgagctgt tcgccgaagt gggatacgac cgagccacca tccgcgccat cgcggcccgt       120
     gcgggcgtcg acgtggcgct cgtctcgtac tactacggca acaagaaggg cctgttccgg       180
     ggtgtgatga gcatgccggt cgatccggag gcgatcttca ccgccgcgct cgacggtccg       240
     cgcgacgggg tgggcgagcg gctactgcgg gccgcgctca ccatctggga agggccggag       300
     acctcggagg ccttccgggc gctgctccgt gccgccgccg acgcggacga gggcgcggcg       360
     cggaccttcg gcgaattcct gtcgtcggtg atgatcccga cgctcaccac gcacgcgggc       420
     gtaggtatcg agacggcccg cgtggtcgcc agcaacctgt tcgggctggc cttcctgcgg       480
     tacctgatcg cggcaccgct gttcgtcgcg ccgtcgaccg aggaattgat cgcgacctac       540
     ggtgcggcgg tccagcggat catcgacgct gacgccggct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page