(data stored in ACNUC1104 zone)

EMBL: CP001966.PE453

CP001966.PE453       Location/Qualifiers
FT   CDS_pept        493808..494359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0466"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rer:RER_53690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77107"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D5US40"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADG77107.1"
FT                   /translation="MAYVTRLRGAVAGLAGSGPLYSPDDAPPAPVAIAFGASVRGGRPG
FT                   SFVEGRLEAALRLYRIGKVQRILVSGNANGLSGDEIEVMTRWLRERGVPDEALLTDGAA
FT                   LDTYLSCVHARDRFGIDRVLLVSQFFHARRAVVLARHLGLDADAVRAEAGCSRRAWVRN
FT                   LAREYLLSRPKAALDIARNR"
     atggcatacg tcacccgact gcgtggcgcg gtggcgggcc tggcgggctc cggcccgctg        60
     tattcgcccg acgatgcgcc gcccgccccc gtcgccatcg cgttcggcgc ctccgtacga       120
     ggcggccgtc ctgggtcgtt cgtcgagggg cgattggagg ccgcgctgcg gctgtaccgg       180
     atcgggaagg ttcagcggat cctggtctcg gggaacgcga acggtttgtc cggcgacgag       240
     atcgaggtca tgactcgctg gctgcgcgag cgcggcgtgc ccgacgaggc gctcctcacc       300
     gacggtgccg ccctcgacac gtacctttcc tgcgtccatg cgagggatcg attcgggatc       360
     gaccgggtgc tgctggtctc gcagttcttc catgcgcggc gggctgtcgt gctcgcccgc       420
     catctcggcc tcgatgccga tgccgtgcgc gccgaggccg gctgcagtcg ccgggcctgg       480
     gtgcgcaatc tggcccggga gtacctgctg tcccgcccca aagccgccct ggacatcgcc       540
     cgcaaccgtt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page