(data stored in ACNUC1104 zone)

EMBL: CP001966.PE454

CP001966.PE454       Location/Qualifiers
FT   CDS_pept        494382..494711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77108"
FT                   /db_xref="GOA:D5US41"
FT                   /db_xref="UniProtKB/TrEMBL:D5US41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77108.1"
FT                   /translation="MNRRVLGEVGRAIAVLAVIVAGGVVGFGSWALMFVQADARGMGVD
FT                   PGAGLALGFLGLIWSGVCLVAAGVAGDLLVYGESRRARLVGIGVMALILACTGLLLWCV
FT                   AKLSL"
     gtgaatcgac gggtactggg tgaggtcggg cgtgcgatcg cggttctggc ggtcatcgtg        60
     gcgggcggcg tcgtggggtt cggctcctgg gctctgatgt tcgtacaggc cgacgcccgc       120
     ggcatggggg tcgacccggg cgccgggctc gccctcggtt tcctcggcct catctggtcg       180
     ggggtctgcc tggtggcagc gggtgtcgcc ggggatctgc tcgtctacgg cgaatcgcgg       240
     cgggcgcgcc tggttgggat cggcgtgatg gcgttgatcc tcgcgtgcac ggggttgctg       300
     ctctggtgcg tcgcgaaact gtcgctgtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page