(data stored in ACNUC1104 zone)

EMBL: CP001966.PE455

CP001966.PE455       Location/Qualifiers
FT   CDS_pept        494882..495841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0468"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Polyketide
FT                   cyclase/dehydrase; KEGG: fal:FRAAL5132 TetR family
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77109"
FT                   /db_xref="GOA:D5US42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5US42"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77109.1"
FT                   /translation="MYRERGDERSIEIAAPPEAVWRVLMDFSAYPEWNPMVRTIAGTPR
FT                   VGERLDVEVNNNGSAIRFSPTVLGVDPDREFRWVGRVMVPGLLDGEHYFRLEPTATGTR
FT                   FTQGERFRWRAGPGGRRVDRCGRGLRRVQPCAPRPGAGYDRRVIPDEFDPLSALTPRAR
FT                   QIAGAARDLLEREGWDAVTMRVLADEIGIRAPSLYKHFANKDAVKSALVAVALAESGAA
FT                   LRPTTGVAELLGRYRAVARANPNLYRLATVGPLDRTSLPEGLEDWSGAPFVEVTGDPHA
FT                   AQALWAAAHGLAILEIDGRFPTGTAPDATWNDLARRFG"
     atgtaccggg agcgagggga cgagcgctcc atcgagatcg cggctccgcc cgaagcggtg        60
     tggcgggtgc tcatggactt ctccgcctat cccgagtgga atccgatggt ccgcaccatc       120
     gccggcacgc cccgggtcgg cgaacgcctc gacgtcgagg tgaacaacaa cggcagcgcc       180
     attcgcttct ccccgacggt gctcggggtc gacccggacc gcgagttccg ctgggtgggc       240
     cgcgtcatgg tgccgggcct gctggacggc gagcactact tccggctcga acccaccgcg       300
     acgggtaccc gcttcacgca gggggagcgc ttccggtggc gtgctggtcc cggtggccgg       360
     cgcgtcgatc gatgtgggcg aggccttcgg cgcgtccaac cgtgcgctcc gcgaccgggt       420
     gctggctacg atcgccgggt gatccccgac gagttcgatc cactgagcgc gctcaccccg       480
     cgggcgcggc agatcgccgg ggctgcccgc gacctcctcg aacgcgaagg ctgggacgcc       540
     gtgacgatgc gggtgctcgc cgacgagatc ggcatccgag caccgtcgct gtacaagcac       600
     ttcgccaaca aggacgcggt caagtcggcg ctcgtcgcgg ttgcgctggc ggaatccggt       660
     gcggcactgc ggcctacgac cggcgttgcg gaactcctcg ggcgctaccg cgccgtcgcc       720
     cgcgccaatc cgaacctgta ccgcctcgcc accgtcgggc cgctcgaccg gacgtcgctt       780
     cccgagggac tcgaggattg gtcgggtgct ccgttcgtgg aggtgacagg tgatccgcat       840
     gccgcccagg cgctgtgggc ggccgcgcac ggcctggcca tcttggagat cgacggcagg       900
     tttcccaccg gcaccgctcc cgacgcgacc tggaacgacc tcgcccgccg attcgggtag       960
//

If you have problems or comments...

PBIL Back to PBIL home page