(data stored in ACNUC1104 zone)

EMBL: CP001966.PE458

CP001966.PE458       Location/Qualifiers
FT   CDS_pept        complement(497482..498531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_53080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77112"
FT                   /db_xref="UniProtKB/TrEMBL:D5US45"
FT                   /inference="similar to AA sequence:KEGG:RER_53080"
FT                   /protein_id="ADG77112.1"
FT                   /translation="MPHTLSTLAATLGTALFSATDSGRLAASRTPFAHHDVMVPHTDSR
FT                   LWGTTHFGVFVPDLPAPHRYVNTMTLIGAPGAEVFDQDYLAAPDARNTTTVLSSTAKDD
FT                   QHFYRAYDASTDCDFAPDGSSLHWGDELTITVDLPTVTVRGRYPGFDVDLTLQVTDQVS
FT                   YFVKTPLYDHFSLAAPYTGTVDGVQVSGLGTFEYARIRGMAQALTPRPVPAPLKLPIDF
FT                   FTYQIIDVDPSTQLLLTDVRARENVACRLLHVRRLGEPAQVYDDVALHVTEWESRVDEQ
FT                   GRSMRVPNRFTWAVCEGRDRVLEIDCVVDSPWRYGHGPGYVAAYSYAGTFESKPVRGSA
FT                   YIEWIDVRP"
     gtgccgcaca cgctctccac cctcgctgcc acactcggca ccgccctgtt ctcagccacc        60
     gattccggac gtctcgccgc ctcgcgaacg cctttcgctc accacgacgt gatggttccg       120
     cacaccgatt cccggctgtg gggcacgacg catttcggcg ttttcgttcc ggatctgcct       180
     gcgccgcatc ggtacgtgaa cacgatgacg ctgatcggcg ccccgggagc ggaggtcttc       240
     gatcaggact atctcgcagc gccggatgcc cgtaacacca ccacggtgtt gtcgtcgacc       300
     gccaaggacg accagcactt ctaccgggcc tacgacgcga gcacggactg cgacttcgcg       360
     cccgacggct cgtcgctgca ctggggcgac gagctgacga tcaccgtcga cctaccgact       420
     gtaacggtgc gcggacgcta cccgggcttc gacgtcgacc tcaccctgca ggtcaccgat       480
     caggtctcct acttcgtgaa aacccctctg tacgatcact tcagcctcgc tgcgccgtac       540
     accggcaccg tcgacggggt gcaggtctcc ggtctcggca ccttcgagta cgcccgcatc       600
     cgcggtatgg cgcaggcact cacaccgcgc cccgtgcccg caccgctgaa gctgccgatc       660
     gacttcttca cataccagat catcgacgtc gacccgtcga cgcagctgct gctcaccgac       720
     gtgcgcgccc gcgagaacgt ggcgtgccgg ctgctgcacg tgcggcgcct gggcgagccg       780
     gcgcaggtgt acgacgatgt ggcactgcac gtgaccgagt gggagtcccg cgtcgacgag       840
     caaggccgct cgatgcgggt gccgaaccgg ttcacctggg ccgtctgcga gggccgcgac       900
     cgggtcctgg agatcgattg cgtggtcgac tcgccgtggc gctacgggca cggccccggt       960
     tacgtggcgg cctacagcta cgcgggcacg ttcgagtcga agccggtgcg cggcagcgcc      1020
     tacatcgagt ggatcgacgt ccgcccctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page