(data stored in ACNUC1104 zone)

EMBL: CP001966.PE459

CP001966.PE459       Location/Qualifiers
FT   CDS_pept        498620..499429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0472"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   krh:KRH_20840 phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77113"
FT                   /db_xref="GOA:D5US46"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:D5US46"
FT                   /inference="protein motif:PFAM:PF00494"
FT                   /protein_id="ADG77113.1"
FT                   /translation="MDSTERYTAAAVAASAVVIRQYSTSFSLASRMMPRRVRSHITSIY
FT                   GLVRVADEVVDGACPVDPRAHLDALEVATERAIETGFSTDLVVHAFANTARATGFGTEL
FT                   TRPFFASMRADLTPAPHTAESLAQYIYGSAEVVGLMCLRAYLHGAAPSDYEALASDAKR
FT                   LGAAFQKINFLRDLTDDELRLGRAYLPELTPDAYAAALADAREDLEQARRGIARLPGDV
FT                   RRGVRAAADLYSALLHRLEAAGLDGARAGRVRVPAASKLLAVVRGVR"
     atggattcca ccgagcggta cacggccgcg gccgttgcgg cctccgcggt cgtgatccgc        60
     cagtactcga catcgttctc gctggccagc cggatgatgc cgcgccgtgt acgctcgcac       120
     atcacatcga tctacgggct cgtgcgcgtc gcggatgagg tggtcgacgg tgcctgtccg       180
     gtcgatccgc gcgcacatct cgatgcactg gaggtggcca cggagcgcgc gatcgagact       240
     ggtttcagca ccgacctggt ggtgcacgcc ttcgcgaata ccgcgcgcgc aaccggattc       300
     ggcaccgagc tcacgcgccc gttcttcgct tcgatgcgcg ccgacctcac ccccgcgccg       360
     catacggccg aatcgctggc gcaatacatc tacggttccg cggaagtagt cgggttgatg       420
     tgcctgcgcg cctacctcca cggggcggcg ccgtcggact acgaagcgct cgcatccgac       480
     gcgaaacgcc tgggcgcggc gttccagaag atcaacttcc tgcgtgacct caccgatgac       540
     gaactgcgcc tgggccgcgc ctacctcccc gagctgacgc ccgacgccta tgcggccgcg       600
     ctcgcggacg ctcgcgagga cctggaacag gcccgacggg gcatcgcccg actcccaggt       660
     gatgtgcggc gcggcgtgcg cgccgccgcc gacctgtatt ccgctctgct gcaccggctg       720
     gaggccgccg ggctcgacgg tgcccgcgcc ggtcgtgtcc gcgtccccgc ggcctcgaag       780
     ctgctcgcgg tggtccgcgg cgtccgctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page