(data stored in ACNUC1104 zone)

EMBL: CP001966.PE460

CP001966.PE460       Location/Qualifiers
FT   CDS_pept        499506..500516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_2817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77114"
FT                   /db_xref="GOA:D5US47"
FT                   /db_xref="UniProtKB/TrEMBL:D5US47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77114.1"
FT                   /translation="MALDDWPERDRRWAARYILCLAVKQDVSYEASEARQAELIAAVES
FT                   AGLPAAELFGDPDEAAAADGADIRSSEPPPAPLLGGGRQDGIDAMGVAYLTVGVPAAIL
FT                   VPMVGGARVDVTVGTVALMAGIVIALFAGGAAWSAAAEGYPRRAMALGLTAVAAALFAA
FT                   SQVSWPNRADVLVAGLPSWIAVPAILAPGIVALVVARFVSNEPRQAEEYTDDQWFMRFR
FT                   DVLRSRWVSADVIDEHVRSLRADLPDVSTATEEYGDPVALARRLANDDSAADRRRWTWK
FT                   AAAFAVFAFLVLFGAITSLIGDGPSWGVLAPIAVVFLYAPTALKSWRSRPRKAGA"
     atggcgctgg acgattggcc cgagcgcgac cggcggtggg cggcgcgcta catcctgtgc        60
     ctcgccgtga agcaggacgt ctcgtacgag gcgagcgagg cgcggcaggc cgaactgatc       120
     gccgccgtcg aatcggccgg actgcccgcc gccgaactgt tcggtgatcc ggatgaagcg       180
     gcggccgccg acggcgccga tattcgctcc tcggagccac cgcccgcgcc gctgctgggc       240
     ggcggccgac aggacggcat cgacgcgatg ggggtggcct atctgaccgt gggtgtcccc       300
     gcggcgatcc tggtgccgat ggtcggtggc gcgcgggtcg acgtcaccgt gggcaccgtg       360
     gcgctgatgg ccgggatcgt catcgccctg ttcgcgggcg gcgccgcctg gtcggcggcg       420
     gccgagggct atccgcgccg ggctatggca ctggggctga cggcggtggc ggcagccctc       480
     ttcgccgcat cgcaggtctc gtggccgaat cgggcggatg tgctcgtcgc cggcctccca       540
     tcgtggatcg cggtcccggc gatactcgca ccgggaatcg tcgcgctggt ggttgcgcga       600
     ttcgtgtcga acgaaccgcg gcaggcggag gagtacaccg atgatcaatg gttcatgcga       660
     ttccgagatg tgttgcgcag caggtgggta tccgccgacg tgatcgacga gcacgtgcgg       720
     tcgctacgtg ccgaccttcc cgatgtgagc accgcgaccg aggagtacgg cgatcccgtc       780
     gcgctcgccc ggcggctcgc gaacgacgac tcggcagcgg atcgccgccg gtggacgtgg       840
     aaggcggcgg cgtttgcggt gttcgccttc ctcgtcctgt tcggtgcgat cacttcactg       900
     atcggcgacg gcccgtcctg gggcgtgctc gcgccgatcg cggtggtgtt cctgtacgcg       960
     ccgacggcgc tgaagtcctg gcgatcgcgg ccgcggaagg ccggggcatg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page